data_2LVX # _entry.id 2LVX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LVX pdb_00002lvx 10.2210/pdb2lvx/pdb RCSB RCSB102898 ? ? BMRB 18592 ? 10.13018/BMR18592 WWPDB D_1000102898 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-01 2 'Structure model' 1 1 2013-05-22 3 'Structure model' 1 2 2013-07-17 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LVX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-07-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18592 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dahms, N.M.' 1 'Olson, L.J.' 2 'Peterson, F.C.' 3 # _citation.id primary _citation.title ;Structure of the Lectin Mannose 6-Phosphate Receptor Homology (MRH) Domain of Glucosidase II, an Enzyme That Regulates Glycoprotein Folding Quality Control in the Endoplasmic Reticulum. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 16460 _citation.page_last 16475 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23609449 _citation.pdbx_database_id_DOI 10.1074/jbc.M113.450239 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Olson, L.J.' 1 ? primary 'Orsi, R.' 2 ? primary 'Alculumbre, S.G.' 3 ? primary 'Peterson, F.C.' 4 ? primary 'Stigliano, I.D.' 5 ? primary 'Parodi, A.J.' 6 ? primary ;D'Alessio, C. ; 7 ? primary 'Dahms, N.M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Glucosidase 2 subunit beta' _entity.formula_weight 10543.977 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.84 _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 380-473' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Alpha-glucosidase 2 subunit beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCWNGPHRSAIVTVECGVENEIVSVLEAQK CEYLIKMKSPAACS ; _entity_poly.pdbx_seq_one_letter_code_can ;YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCWNGPHRSAIVTVECGVENEIVSVLEAQK CEYLIKMKSPAACS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 ARG n 1 3 ALA n 1 4 ILE n 1 5 LYS n 1 6 GLY n 1 7 MET n 1 8 GLU n 1 9 THR n 1 10 LYS n 1 11 ARG n 1 12 GLU n 1 13 ILE n 1 14 GLY n 1 15 GLY n 1 16 TYR n 1 17 THR n 1 18 TYR n 1 19 LYS n 1 20 VAL n 1 21 VAL n 1 22 PHE n 1 23 TYR n 1 24 GLU n 1 25 ASN n 1 26 VAL n 1 27 PHE n 1 28 GLN n 1 29 ASP n 1 30 SER n 1 31 ILE n 1 32 LEU n 1 33 LEU n 1 34 GLY n 1 35 ASN n 1 36 PHE n 1 37 ALA n 1 38 SER n 1 39 GLN n 1 40 GLU n 1 41 GLY n 1 42 ASN n 1 43 VAL n 1 44 LEU n 1 45 LYS n 1 46 TYR n 1 47 GLU n 1 48 ASN n 1 49 GLY n 1 50 GLN n 1 51 SER n 1 52 CYS n 1 53 TRP n 1 54 ASN n 1 55 GLY n 1 56 PRO n 1 57 HIS n 1 58 ARG n 1 59 SER n 1 60 ALA n 1 61 ILE n 1 62 VAL n 1 63 THR n 1 64 VAL n 1 65 GLU n 1 66 CYS n 1 67 GLY n 1 68 VAL n 1 69 GLU n 1 70 ASN n 1 71 GLU n 1 72 ILE n 1 73 VAL n 1 74 SER n 1 75 VAL n 1 76 LEU n 1 77 GLU n 1 78 ALA n 1 79 GLN n 1 80 LYS n 1 81 CYS n 1 82 GLU n 1 83 TYR n 1 84 LEU n 1 85 ILE n 1 86 LYS n 1 87 MET n 1 88 LYS n 1 89 SER n 1 90 PRO n 1 91 ALA n 1 92 ALA n 1 93 CYS n 1 94 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Fission yeast' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'gtb1, SPCC825.02' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain '972 / ATCC 24843' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 284812 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21[pREP4]' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pQE30-SUMO _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 357 357 TYR TYR A . n A 1 2 ARG 2 358 358 ARG ARG A . n A 1 3 ALA 3 359 359 ALA ALA A . n A 1 4 ILE 4 360 360 ILE ILE A . n A 1 5 LYS 5 361 361 LYS LYS A . n A 1 6 GLY 6 362 362 GLY GLY A . n A 1 7 MET 7 363 363 MET MET A . n A 1 8 GLU 8 364 364 GLU GLU A . n A 1 9 THR 9 365 365 THR THR A . n A 1 10 LYS 10 366 366 LYS LYS A . n A 1 11 ARG 11 367 367 ARG ARG A . n A 1 12 GLU 12 368 368 GLU GLU A . n A 1 13 ILE 13 369 369 ILE ILE A . n A 1 14 GLY 14 370 370 GLY GLY A . n A 1 15 GLY 15 371 371 GLY GLY A . n A 1 16 TYR 16 372 372 TYR TYR A . n A 1 17 THR 17 373 373 THR THR A . n A 1 18 TYR 18 374 374 TYR TYR A . n A 1 19 LYS 19 375 375 LYS LYS A . n A 1 20 VAL 20 376 376 VAL VAL A . n A 1 21 VAL 21 377 377 VAL VAL A . n A 1 22 PHE 22 378 378 PHE PHE A . n A 1 23 TYR 23 379 379 TYR TYR A . n A 1 24 GLU 24 380 380 GLU GLU A . n A 1 25 ASN 25 381 381 ASN ASN A . n A 1 26 VAL 26 382 382 VAL VAL A . n A 1 27 PHE 27 383 383 PHE PHE A . n A 1 28 GLN 28 384 384 GLN GLN A . n A 1 29 ASP 29 385 385 ASP ASP A . n A 1 30 SER 30 386 386 SER SER A . n A 1 31 ILE 31 387 387 ILE ILE A . n A 1 32 LEU 32 388 388 LEU LEU A . n A 1 33 LEU 33 389 389 LEU LEU A . n A 1 34 GLY 34 390 390 GLY GLY A . n A 1 35 ASN 35 391 391 ASN ASN A . n A 1 36 PHE 36 392 392 PHE PHE A . n A 1 37 ALA 37 393 393 ALA ALA A . n A 1 38 SER 38 394 394 SER SER A . n A 1 39 GLN 39 395 395 GLN GLN A . n A 1 40 GLU 40 396 396 GLU GLU A . n A 1 41 GLY 41 397 397 GLY GLY A . n A 1 42 ASN 42 398 398 ASN ASN A . n A 1 43 VAL 43 399 399 VAL VAL A . n A 1 44 LEU 44 400 400 LEU LEU A . n A 1 45 LYS 45 401 401 LYS LYS A . n A 1 46 TYR 46 402 402 TYR TYR A . n A 1 47 GLU 47 403 403 GLU GLU A . n A 1 48 ASN 48 404 404 ASN ASN A . n A 1 49 GLY 49 405 405 GLY GLY A . n A 1 50 GLN 50 406 406 GLN GLN A . n A 1 51 SER 51 407 407 SER SER A . n A 1 52 CYS 52 408 408 CYS CYS A . n A 1 53 TRP 53 409 409 TRP TRP A . n A 1 54 ASN 54 410 410 ASN ASN A . n A 1 55 GLY 55 411 411 GLY GLY A . n A 1 56 PRO 56 412 412 PRO PRO A . n A 1 57 HIS 57 413 413 HIS HIS A . n A 1 58 ARG 58 414 414 ARG ARG A . n A 1 59 SER 59 415 415 SER SER A . n A 1 60 ALA 60 416 416 ALA ALA A . n A 1 61 ILE 61 417 417 ILE ILE A . n A 1 62 VAL 62 418 418 VAL VAL A . n A 1 63 THR 63 419 419 THR THR A . n A 1 64 VAL 64 420 420 VAL VAL A . n A 1 65 GLU 65 421 421 GLU GLU A . n A 1 66 CYS 66 422 422 CYS CYS A . n A 1 67 GLY 67 423 423 GLY GLY A . n A 1 68 VAL 68 424 424 VAL VAL A . n A 1 69 GLU 69 425 425 GLU GLU A . n A 1 70 ASN 70 426 426 ASN ASN A . n A 1 71 GLU 71 427 427 GLU GLU A . n A 1 72 ILE 72 428 428 ILE ILE A . n A 1 73 VAL 73 429 429 VAL VAL A . n A 1 74 SER 74 430 430 SER SER A . n A 1 75 VAL 75 431 431 VAL VAL A . n A 1 76 LEU 76 432 432 LEU LEU A . n A 1 77 GLU 77 433 433 GLU GLU A . n A 1 78 ALA 78 434 434 ALA ALA A . n A 1 79 GLN 79 435 435 GLN GLN A . n A 1 80 LYS 80 436 436 LYS LYS A . n A 1 81 CYS 81 437 437 CYS CYS A . n A 1 82 GLU 82 438 438 GLU GLU A . n A 1 83 TYR 83 439 439 TYR TYR A . n A 1 84 LEU 84 440 440 LEU LEU A . n A 1 85 ILE 85 441 441 ILE ILE A . n A 1 86 LYS 86 442 442 LYS LYS A . n A 1 87 MET 87 443 443 MET MET A . n A 1 88 LYS 88 444 444 LYS LYS A . n A 1 89 SER 89 445 445 SER SER A . n A 1 90 PRO 90 446 446 PRO PRO A . n A 1 91 ALA 91 447 447 ALA ALA A . n A 1 92 ALA 92 448 448 ALA ALA A . n A 1 93 CYS 93 449 449 CYS CYS A . n A 1 94 SER 94 450 450 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LVX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LVX _struct.title 'MRH domain of the Glucosidase II beta subunit from S. pombe' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LVX _struct_keywords.pdbx_keywords 'HYDROLASE, sugar binding protein' _struct_keywords.text 'MRH domain, Lectin, glycobiology, protein folding, HYDROLASE, sugar binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLU2B_SCHPO _struct_ref.pdbx_db_accession Q9USH8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCWNGPHRSAIVTVECGVENEIVSVLEAQK CEYLIKMKSPAACS ; _struct_ref.pdbx_align_begin 380 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LVX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9USH8 _struct_ref_seq.db_align_beg 380 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 473 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 357 _struct_ref_seq.pdbx_auth_seq_align_end 450 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 90 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 93 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 446 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 449 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 52 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 408 A CYS 437 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 93 SG ? ? A CYS 422 A CYS 449 1_555 ? ? ? ? ? ? ? 2.033 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 52 ? CYS A 81 ? CYS A 408 ? 1_555 CYS A 437 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 66 ? CYS A 93 ? CYS A 422 ? 1_555 CYS A 449 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 8 ? ILE A 13 ? GLU A 364 ILE A 369 A 2 TYR A 16 ? VAL A 21 ? TYR A 372 VAL A 377 A 3 ASN A 25 ? GLN A 28 ? ASN A 381 GLN A 384 A 4 ILE A 31 ? GLU A 40 ? ILE A 387 GLU A 396 A 5 VAL A 43 ? ASN A 48 ? VAL A 399 ASN A 404 A 6 SER A 59 ? CYS A 66 ? SER A 415 CYS A 422 A 7 GLU A 82 ? SER A 89 ? GLU A 438 SER A 445 A 8 GLU A 71 ? GLU A 77 ? GLU A 427 GLU A 433 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 13 ? N ILE A 369 O TYR A 16 ? O TYR A 372 A 2 3 N LYS A 19 ? N LYS A 375 O PHE A 27 ? O PHE A 383 A 3 4 N GLN A 28 ? N GLN A 384 O ILE A 31 ? O ILE A 387 A 4 5 N ASN A 35 ? N ASN A 391 O GLU A 47 ? O GLU A 403 A 5 6 N LEU A 44 ? N LEU A 400 O VAL A 62 ? O VAL A 418 A 6 7 N ILE A 61 ? N ILE A 417 O ILE A 85 ? O ILE A 441 A 7 8 O LEU A 84 ? O LEU A 440 N LEU A 76 ? N LEU A 432 # _pdbx_entry_details.entry_id 2LVX _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 18 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 364 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HZ1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 366 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 380 ? ? -116.68 -85.56 2 1 ASP A 385 ? ? 69.15 -86.44 3 1 GLN A 435 ? ? -126.14 -76.20 4 1 LYS A 436 ? ? -164.95 -41.31 5 2 GLU A 364 ? ? 70.72 146.97 6 2 GLU A 380 ? ? -136.49 -83.46 7 2 ASP A 385 ? ? 69.44 -83.35 8 2 GLN A 435 ? ? -116.23 -70.26 9 2 LYS A 436 ? ? -172.99 -24.27 10 3 MET A 363 ? ? 50.04 -45.52 11 3 GLU A 364 ? ? 78.24 113.50 12 3 GLU A 380 ? ? -120.82 -84.32 13 3 ASP A 385 ? ? 69.94 -83.93 14 3 GLN A 435 ? ? -109.27 -78.44 15 3 LYS A 436 ? ? -160.67 -40.32 16 4 MET A 363 ? ? -146.39 -27.91 17 4 GLU A 364 ? ? 65.70 139.53 18 4 GLU A 380 ? ? -125.42 -80.80 19 4 ASP A 385 ? ? 72.60 -70.76 20 4 SER A 386 ? ? -152.87 -0.61 21 4 GLN A 435 ? ? -127.64 -80.01 22 4 LYS A 436 ? ? -166.73 -36.32 23 5 ARG A 358 ? ? -134.81 -116.62 24 5 GLU A 364 ? ? 69.72 124.54 25 5 GLU A 380 ? ? -130.93 -84.42 26 5 ASP A 385 ? ? 73.23 -72.93 27 5 SER A 386 ? ? -148.63 -5.15 28 5 GLN A 435 ? ? -109.33 -75.02 29 5 LYS A 436 ? ? -165.84 -43.02 30 6 GLU A 380 ? ? -122.61 -84.46 31 6 ASP A 385 ? ? 71.52 -82.34 32 6 GLN A 435 ? ? -98.08 -76.50 33 6 LYS A 436 ? ? -162.89 -43.85 34 6 SER A 445 ? ? -172.10 148.55 35 7 GLU A 380 ? ? -126.73 -83.10 36 7 ASP A 385 ? ? 72.45 -78.57 37 7 SER A 386 ? ? -142.06 -3.06 38 7 ASN A 426 ? ? -67.68 99.12 39 7 GLN A 435 ? ? -107.04 -84.45 40 7 LYS A 436 ? ? -147.66 -56.53 41 8 GLU A 380 ? ? -116.30 -82.21 42 8 ASP A 385 ? ? 70.43 -81.47 43 8 GLN A 435 ? ? -116.94 -73.87 44 8 LYS A 436 ? ? -164.23 -51.79 45 9 GLU A 380 ? ? -117.64 -91.22 46 9 ASP A 385 ? ? 70.17 -77.06 47 9 GLN A 435 ? ? -142.07 -73.85 48 9 LYS A 436 ? ? -163.69 -49.01 49 10 GLU A 380 ? ? -118.80 -84.49 50 10 ASP A 385 ? ? 69.64 -83.84 51 10 ASN A 410 ? ? 80.40 -29.80 52 10 ASN A 426 ? ? -69.57 97.95 53 10 GLN A 435 ? ? -121.47 -82.24 54 10 LYS A 436 ? ? -145.31 -61.73 55 11 ARG A 358 ? ? 55.35 -161.11 56 11 GLU A 380 ? ? -125.71 -86.18 57 11 ASP A 385 ? ? 69.10 -87.02 58 11 GLN A 435 ? ? -119.55 -71.49 59 11 LYS A 436 ? ? -162.39 -42.14 60 11 SER A 445 ? ? -172.45 145.69 61 12 ARG A 358 ? ? 70.50 -39.47 62 12 GLU A 380 ? ? -125.91 -83.41 63 12 ASP A 385 ? ? 72.38 -80.67 64 12 SER A 386 ? ? -142.69 -1.88 65 12 GLN A 435 ? ? -129.29 -78.68 66 12 LYS A 436 ? ? -168.05 -40.25 67 13 GLU A 380 ? ? -124.80 -77.24 68 13 ASP A 385 ? ? 68.19 -84.03 69 13 SER A 394 ? ? -173.24 149.80 70 13 GLN A 435 ? ? -120.93 -72.92 71 13 LYS A 436 ? ? -167.51 -40.61 72 14 GLU A 380 ? ? -115.89 -83.67 73 14 ASP A 385 ? ? 72.03 -76.16 74 14 SER A 386 ? ? -145.31 -6.52 75 14 ASN A 410 ? ? 153.18 -32.57 76 14 ASN A 426 ? ? -51.04 100.73 77 14 GLN A 435 ? ? -133.06 -77.93 78 14 LYS A 436 ? ? -167.35 -39.80 79 14 SER A 445 ? ? -172.92 146.66 80 15 ARG A 358 ? ? -89.23 36.93 81 15 GLU A 380 ? ? -125.34 -82.52 82 15 ASP A 385 ? ? 69.17 -87.66 83 15 GLN A 435 ? ? -132.38 -78.03 84 15 LYS A 436 ? ? -157.22 -50.28 85 15 SER A 445 ? ? -172.22 148.55 86 16 GLU A 380 ? ? -119.42 -84.81 87 16 ASP A 385 ? ? 70.49 -80.66 88 16 GLN A 435 ? ? -122.79 -68.21 89 16 LYS A 436 ? ? -166.03 -27.28 90 17 GLU A 380 ? ? -128.79 -82.75 91 17 ASP A 385 ? ? 72.12 -82.96 92 17 GLN A 435 ? ? -121.38 -74.36 93 17 LYS A 436 ? ? -175.55 -10.12 94 18 GLU A 380 ? ? -132.36 -79.80 95 18 ASP A 385 ? ? 71.67 -79.65 96 18 SER A 386 ? ? -144.73 -4.02 97 18 ASN A 426 ? ? -62.36 99.64 98 18 GLN A 435 ? ? -120.10 -77.79 99 18 LYS A 436 ? ? -169.94 -47.36 100 19 GLU A 380 ? ? -124.11 -83.30 101 19 ASP A 385 ? ? 70.76 -74.66 102 19 SER A 386 ? ? -146.94 -7.20 103 19 GLN A 435 ? ? -106.23 -76.24 104 19 LYS A 436 ? ? -162.80 -30.35 105 20 ARG A 358 ? ? -163.15 28.00 106 20 GLU A 380 ? ? -123.24 -86.84 107 20 ASP A 385 ? ? 69.89 -78.37 108 20 ASN A 426 ? ? -60.10 98.83 109 20 ALA A 434 ? ? -74.14 -70.42 110 20 GLN A 435 ? ? -100.00 -75.83 111 20 LYS A 436 ? ? -161.10 -51.07 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 18 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 367 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.073 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LVX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LVX _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '10 mM [U-100% 2H] imidazole, 150 mM sodium chloride, 95 % H2O, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id imidazole-1 10 ? mM '[U-100% 2H]' 1 'sodium chloride-2' 150 ? mM ? 1 H2O-3 95 ? % ? 1 D2O-4 5 ? % '[U-99% 2H]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY (AROMATIC)' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LVX _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1800 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 338 _pdbx_nmr_constraints.NOE_long_range_total_count 737 _pdbx_nmr_constraints.NOE_medium_range_total_count 260 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 465 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 61 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 69 # _pdbx_nmr_refine.entry_id 2LVX _pdbx_nmr_refine.method ;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENT. ; _pdbx_nmr_refine.details ;STRUCTURES ARE BASED ON A TOTAL OF 1800 NOE CONSTRAINTS (338 INTRA, 465 SEQUENTIAL, 260 MEDIUM, AND 730 LONG RANGE) AND 130 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal SCHWIETERS,C.D.,KUSZEWSKI,J.J.,TJANDRA,N.,CLORE,G.M. refinement Xplor-NIH 2.9.3 1 Bruker collection TopSpin 2.1 2 'Delagio,F. et al.' processing NMRPipe 2009 3 'Eccles, C., Guntert, P., Billeter, M., Wuthrich, K.' 'data analysis' XEASY 1.3 4 'C. Bartels' 'data analysis' GARANT 2.1 5 'Guntert, P.' 'structural calculation' CYANA 2.1 6 'Guntert, P.' refinement CYANA 2.1 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LVX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_