data_2LW8 # _entry.id 2LW8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LW8 pdb_00002lw8 10.2210/pdb2lw8/pdb RCSB RCSB102909 ? ? BMRB 18613 ? 10.13018/BMR18613 WWPDB D_1000102909 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-24 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 8 3 'Structure model' pdbx_entry_details 9 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LW8 _pdbx_database_status.methods_development_category CASD-NMR _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-07-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18613 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, H.' 1 'Song, J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR solution structure of Eph receptor' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Protein dynamics at Eph receptor-ligand interfaces as revealed by crystallography, NMR and MD simulations.' 'BMC Biophys' 5 2 2 2012 ? UK 2046-1682 ? ? 22277260 10.1186/2046-1682-5-2 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, H.' 1 ? primary 'Fan, J.' 2 ? primary 'Song, J.' 3 ? 1 'Qin, H.' 4 ? 1 'Lim, L.' 5 ? 1 'Song, J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ephrin type-A receptor 4' _entity.formula_weight 20989.758 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Eph LBD domain, UNP residues 29-209' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EPH-like kinase 8, EK8, hEK8, Tyrosine-protein kinase TYRO1, Tyrosine-protein kinase receptor SEK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLR DCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQ DVGACIALVSVRVFYKKAPLTVR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLR DCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQ DVGACIALVSVRVFYKKAPLTVR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASN n 1 4 GLU n 1 5 VAL n 1 6 THR n 1 7 LEU n 1 8 LEU n 1 9 ASP n 1 10 SER n 1 11 ARG n 1 12 SER n 1 13 VAL n 1 14 GLN n 1 15 GLY n 1 16 GLU n 1 17 LEU n 1 18 GLY n 1 19 TRP n 1 20 ILE n 1 21 ALA n 1 22 SER n 1 23 PRO n 1 24 LEU n 1 25 GLU n 1 26 GLY n 1 27 GLY n 1 28 TRP n 1 29 GLU n 1 30 GLU n 1 31 VAL n 1 32 SER n 1 33 ILE n 1 34 MET n 1 35 ASP n 1 36 GLU n 1 37 LYS n 1 38 ASN n 1 39 THR n 1 40 PRO n 1 41 ILE n 1 42 ARG n 1 43 THR n 1 44 TYR n 1 45 GLN n 1 46 VAL n 1 47 CYS n 1 48 ASN n 1 49 VAL n 1 50 MET n 1 51 GLU n 1 52 PRO n 1 53 SER n 1 54 GLN n 1 55 ASN n 1 56 ASN n 1 57 TRP n 1 58 LEU n 1 59 ARG n 1 60 THR n 1 61 ASP n 1 62 TRP n 1 63 ILE n 1 64 THR n 1 65 ARG n 1 66 GLU n 1 67 GLY n 1 68 ALA n 1 69 GLN n 1 70 ARG n 1 71 VAL n 1 72 TYR n 1 73 ILE n 1 74 GLU n 1 75 ILE n 1 76 LYS n 1 77 PHE n 1 78 THR n 1 79 LEU n 1 80 ARG n 1 81 ASP n 1 82 CYS n 1 83 ASN n 1 84 SER n 1 85 LEU n 1 86 PRO n 1 87 GLY n 1 88 VAL n 1 89 MET n 1 90 GLY n 1 91 THR n 1 92 CYS n 1 93 LYS n 1 94 GLU n 1 95 THR n 1 96 PHE n 1 97 ASN n 1 98 LEU n 1 99 TYR n 1 100 TYR n 1 101 TYR n 1 102 GLU n 1 103 SER n 1 104 ASP n 1 105 ASN n 1 106 ASP n 1 107 LYS n 1 108 GLU n 1 109 ARG n 1 110 PHE n 1 111 ILE n 1 112 ARG n 1 113 GLU n 1 114 ASN n 1 115 GLN n 1 116 PHE n 1 117 VAL n 1 118 LYS n 1 119 ILE n 1 120 ASP n 1 121 THR n 1 122 ILE n 1 123 ALA n 1 124 ALA n 1 125 ASP n 1 126 GLU n 1 127 SER n 1 128 PHE n 1 129 THR n 1 130 GLN n 1 131 VAL n 1 132 ASP n 1 133 ILE n 1 134 GLY n 1 135 ASP n 1 136 ARG n 1 137 ILE n 1 138 MET n 1 139 LYS n 1 140 LEU n 1 141 ASN n 1 142 THR n 1 143 GLU n 1 144 ILE n 1 145 ARG n 1 146 ASP n 1 147 VAL n 1 148 GLY n 1 149 PRO n 1 150 LEU n 1 151 SER n 1 152 LYS n 1 153 LYS n 1 154 GLY n 1 155 PHE n 1 156 TYR n 1 157 LEU n 1 158 ALA n 1 159 PHE n 1 160 GLN n 1 161 ASP n 1 162 VAL n 1 163 GLY n 1 164 ALA n 1 165 CYS n 1 166 ILE n 1 167 ALA n 1 168 LEU n 1 169 VAL n 1 170 SER n 1 171 VAL n 1 172 ARG n 1 173 VAL n 1 174 PHE n 1 175 TYR n 1 176 LYS n 1 177 LYS n 1 178 ALA n 1 179 PRO n 1 180 LEU n 1 181 THR n 1 182 VAL n 1 183 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EPHA4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector PET32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ARG 183 183 183 ARG ARG A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LW8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LW8 _struct.title 'NMR solution structure of Eph receptor' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LW8 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Eph receptor, ephrin, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPHA4_HUMAN _struct_ref.pdbx_db_accession P54764 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDC NSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDV GACIALVSVRVFYKKCPLTVR ; _struct_ref.pdbx_align_begin 29 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LW8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54764 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 209 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LW8 GLY A 1 ? UNP P54764 ? ? 'expression tag' 1 1 1 2LW8 SER A 2 ? UNP P54764 ? ? 'expression tag' 2 2 1 2LW8 ALA A 178 ? UNP P54764 CYS 204 conflict 178 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 10 ? GLN A 14 ? SER A 10 GLN A 14 1 ? 5 HELX_P HELX_P2 2 PHE A 110 ? GLN A 115 ? PHE A 110 GLN A 115 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 165 SG ? ? A CYS 47 A CYS 165 1_555 ? ? ? ? ? ? ? 1.976 ? ? disulf2 disulf ? ? A CYS 82 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 82 A CYS 92 1_555 ? ? ? ? ? ? ? 2.087 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 47 ? CYS A 165 ? CYS A 47 ? 1_555 CYS A 165 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 82 ? CYS A 92 ? CYS A 82 ? 1_555 CYS A 92 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 8 ? ASP A 9 ? LEU A 8 ASP A 9 A 2 ILE A 166 ? PHE A 174 ? ILE A 166 PHE A 174 A 3 ILE A 41 ? VAL A 46 ? ILE A 41 VAL A 46 A 4 GLU A 29 ? ILE A 33 ? GLU A 29 ILE A 33 B 1 LEU A 8 ? ASP A 9 ? LEU A 8 ASP A 9 B 2 ILE A 166 ? PHE A 174 ? ILE A 166 PHE A 174 B 3 TYR A 72 ? LEU A 79 ? TYR A 72 LEU A 79 B 4 LEU A 140 ? ARG A 145 ? LEU A 140 ARG A 145 B 5 PHE A 128 ? THR A 129 ? PHE A 128 THR A 129 C 1 ASN A 56 ? THR A 60 ? ASN A 56 THR A 60 C 2 LEU A 157 ? ASP A 161 ? LEU A 157 ASP A 161 C 3 ASN A 97 ? TYR A 100 ? ASN A 97 TYR A 100 C 4 VAL A 117 ? LYS A 118 ? VAL A 117 LYS A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 8 ? N LEU A 8 O VAL A 173 ? O VAL A 173 A 2 3 O LEU A 168 ? O LEU A 168 N TYR A 44 ? N TYR A 44 A 3 4 O ILE A 41 ? O ILE A 41 N ILE A 33 ? N ILE A 33 B 1 2 N LEU A 8 ? N LEU A 8 O VAL A 173 ? O VAL A 173 B 2 3 O PHE A 174 ? O PHE A 174 N TYR A 72 ? N TYR A 72 B 3 4 N ILE A 73 ? N ILE A 73 O ARG A 145 ? O ARG A 145 B 4 5 O LEU A 140 ? O LEU A 140 N THR A 129 ? N THR A 129 C 1 2 N THR A 60 ? N THR A 60 O LEU A 157 ? O LEU A 157 C 2 3 O ALA A 158 ? O ALA A 158 N TYR A 99 ? N TYR A 99 C 3 4 N TYR A 100 ? N TYR A 100 O VAL A 117 ? O VAL A 117 # _pdbx_entry_details.entry_id 2LW8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 98 ? ? H A ILE 119 ? ? 1.50 2 1 O A TYR 72 ? ? H A PHE 174 ? ? 1.51 3 1 H A LYS 76 ? ? O A SER 170 ? ? 1.52 4 1 O A LYS 76 ? ? H A VAL 169 ? ? 1.57 5 2 O A LEU 98 ? ? H A ILE 119 ? ? 1.50 6 2 H A LYS 76 ? ? O A SER 170 ? ? 1.52 7 2 H A VAL 31 ? ? O A THR 43 ? ? 1.57 8 2 H A LEU 7 ? ? O A VAL 173 ? ? 1.58 9 2 O A TYR 100 ? ? H A VAL 117 ? ? 1.59 10 3 H A LYS 76 ? ? O A SER 170 ? ? 1.49 11 4 O A LEU 98 ? ? H A ILE 119 ? ? 1.51 12 4 H A LYS 76 ? ? O A SER 170 ? ? 1.55 13 4 H A LEU 7 ? ? O A VAL 173 ? ? 1.57 14 5 O A ILE 73 ? ? H A ARG 145 ? ? 1.47 15 5 O A TYR 44 ? ? H A LEU 168 ? ? 1.54 16 5 H A ILE 73 ? ? O A ARG 145 ? ? 1.55 17 5 H A LYS 93 ? ? O A GLY 163 ? ? 1.55 18 5 O A ILE 111 ? ? H A GLN 115 ? ? 1.59 19 6 O A VAL 31 ? ? H A THR 43 ? ? 1.51 20 6 H A LYS 76 ? ? O A SER 170 ? ? 1.56 21 6 O A THR 78 ? ? H A ALA 167 ? ? 1.57 22 7 O A VAL 31 ? ? H A THR 43 ? ? 1.48 23 7 H A VAL 31 ? ? O A THR 43 ? ? 1.49 24 7 H A ILE 73 ? ? O A ARG 145 ? ? 1.49 25 7 H A LYS 76 ? ? O A SER 170 ? ? 1.51 26 7 O A LEU 98 ? ? H A ILE 119 ? ? 1.53 27 7 O A ILE 73 ? ? H A ARG 145 ? ? 1.54 28 8 H A LYS 93 ? ? O A GLY 163 ? ? 1.51 29 8 O A VAL 88 ? ? H A GLY 90 ? ? 1.59 30 9 H A LYS 93 ? ? O A GLY 163 ? ? 1.48 31 9 O A GLU 74 ? ? H A ARG 172 ? ? 1.55 32 9 H A THR 60 ? ? O A LEU 157 ? ? 1.57 33 9 H A LYS 76 ? ? O A SER 170 ? ? 1.59 34 9 O A LEU 98 ? ? H A ILE 119 ? ? 1.59 35 10 O A THR 78 ? ? H A ALA 167 ? ? 1.59 36 10 H A LEU 7 ? ? O A VAL 173 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? -126.71 -64.39 2 1 GLN A 14 ? ? 70.00 -61.60 3 1 ILE A 20 ? ? -160.77 35.91 4 1 SER A 22 ? ? 158.67 155.77 5 1 PRO A 23 ? ? -75.03 -166.28 6 1 GLU A 25 ? ? 165.79 151.28 7 1 ASN A 48 ? ? -168.63 103.44 8 1 GLU A 51 ? ? -177.94 108.90 9 1 SER A 53 ? ? 155.87 -22.53 10 1 ASN A 55 ? ? -116.19 73.71 11 1 TRP A 62 ? ? 76.50 61.43 12 1 MET A 89 ? ? 161.46 -47.73 13 1 THR A 91 ? ? -143.45 42.21 14 1 GLU A 94 ? ? -107.08 42.26 15 1 ASP A 106 ? ? -178.57 96.91 16 1 LYS A 107 ? ? -140.83 -63.09 17 1 ARG A 109 ? ? -109.52 77.49 18 1 GLN A 115 ? ? -42.17 107.30 19 1 ILE A 119 ? ? -94.43 -62.03 20 1 ALA A 124 ? ? -57.69 172.41 21 1 ASP A 125 ? ? 80.51 -155.78 22 1 GLU A 126 ? ? 70.99 -62.64 23 1 ARG A 136 ? ? 164.44 -53.97 24 1 ILE A 137 ? ? -48.51 96.19 25 1 PRO A 149 ? ? -74.98 -79.29 26 1 LYS A 153 ? ? 164.77 -163.60 27 2 GLN A 14 ? ? 81.79 -45.94 28 2 GLU A 16 ? ? -65.94 -164.66 29 2 LEU A 17 ? ? 170.85 -26.05 30 2 TRP A 19 ? ? 67.65 155.90 31 2 SER A 22 ? ? 174.39 154.35 32 2 PRO A 23 ? ? -74.94 -163.30 33 2 GLU A 25 ? ? 170.11 151.04 34 2 THR A 39 ? ? 62.63 127.74 35 2 ASN A 48 ? ? -173.38 104.02 36 2 MET A 50 ? ? 178.24 -41.21 37 2 SER A 53 ? ? 171.75 104.53 38 2 ASN A 55 ? ? -151.02 -43.14 39 2 TRP A 62 ? ? 165.49 44.24 40 2 GLN A 69 ? ? -176.13 -37.89 41 2 MET A 89 ? ? 66.58 -62.64 42 2 LYS A 107 ? ? 61.70 -171.43 43 2 GLU A 108 ? ? 84.60 111.47 44 2 ARG A 109 ? ? -176.73 -45.51 45 2 ILE A 119 ? ? -89.50 -75.85 46 2 ALA A 124 ? ? -57.93 90.18 47 2 ASP A 125 ? ? -178.57 -167.17 48 2 GLU A 126 ? ? 72.03 -60.35 49 2 ARG A 136 ? ? 163.33 -51.64 50 2 ILE A 137 ? ? -60.95 96.43 51 2 LEU A 150 ? ? 77.47 152.51 52 2 LYS A 153 ? ? 77.20 49.55 53 3 GLN A 14 ? ? 84.61 -26.62 54 3 GLU A 16 ? ? -61.29 -138.07 55 3 LEU A 17 ? ? 97.43 -9.95 56 3 TRP A 19 ? ? 95.99 150.56 57 3 ALA A 21 ? ? -130.80 -145.75 58 3 SER A 22 ? ? 79.33 157.75 59 3 THR A 39 ? ? 61.50 133.58 60 3 ASN A 48 ? ? -162.34 104.47 61 3 MET A 50 ? ? -140.47 -97.38 62 3 SER A 53 ? ? -80.08 -90.23 63 3 ASN A 56 ? ? 170.09 150.22 64 3 TRP A 62 ? ? 70.42 54.92 65 3 THR A 64 ? ? -173.68 131.38 66 3 GLN A 69 ? ? -177.15 -38.20 67 3 MET A 89 ? ? 74.65 -1.97 68 3 GLU A 94 ? ? -149.41 46.71 69 3 ASP A 106 ? ? 162.35 131.11 70 3 LYS A 107 ? ? -163.34 -93.92 71 3 ARG A 109 ? ? 49.64 88.45 72 3 ILE A 119 ? ? -84.64 -72.17 73 3 ALA A 124 ? ? -58.85 92.98 74 3 ASP A 125 ? ? 175.00 -160.51 75 3 GLU A 126 ? ? 69.86 -60.94 76 3 ARG A 136 ? ? 170.70 -77.76 77 3 LEU A 150 ? ? -178.26 104.95 78 3 LYS A 153 ? ? 41.52 -159.93 79 4 ASN A 3 ? ? 64.57 169.15 80 4 GLN A 14 ? ? 73.20 -56.73 81 4 SER A 22 ? ? 157.56 148.70 82 4 GLU A 25 ? ? 162.28 163.44 83 4 ASN A 48 ? ? 171.43 103.41 84 4 PRO A 52 ? ? -75.06 -160.41 85 4 SER A 53 ? ? -30.31 -83.57 86 4 ASP A 61 ? ? 174.94 -177.71 87 4 TRP A 62 ? ? 176.75 -75.90 88 4 GLN A 69 ? ? -171.02 -39.04 89 4 MET A 89 ? ? 84.51 -42.50 90 4 GLU A 94 ? ? -143.63 35.06 91 4 TYR A 101 ? ? -160.02 115.28 92 4 LYS A 107 ? ? -57.06 171.66 93 4 ARG A 109 ? ? -161.76 -60.55 94 4 ASP A 125 ? ? 174.64 -164.36 95 4 GLU A 126 ? ? 67.97 -61.05 96 4 ARG A 136 ? ? 171.25 172.51 97 4 ILE A 137 ? ? 74.70 81.82 98 4 LYS A 153 ? ? 65.83 120.18 99 5 GLN A 14 ? ? 75.47 -56.86 100 5 SER A 22 ? ? 179.89 136.55 101 5 PRO A 23 ? ? -74.99 -163.48 102 5 GLU A 25 ? ? 163.35 137.09 103 5 ASN A 38 ? ? -65.29 -70.90 104 5 CYS A 47 ? ? -164.05 105.46 105 5 MET A 50 ? ? -173.34 -38.27 106 5 GLU A 51 ? ? 179.20 -58.02 107 5 ASP A 61 ? ? 82.37 162.46 108 5 TRP A 62 ? ? -142.62 -60.41 109 5 ALA A 68 ? ? -88.00 -90.61 110 5 PRO A 86 ? ? -74.98 -88.65 111 5 VAL A 88 ? ? 87.29 -20.13 112 5 MET A 89 ? ? 69.15 -58.30 113 5 THR A 91 ? ? -147.13 43.20 114 5 GLU A 94 ? ? -142.03 42.19 115 5 TYR A 101 ? ? -162.54 101.66 116 5 ARG A 109 ? ? 56.78 165.07 117 5 GLN A 115 ? ? 48.34 -176.85 118 5 ILE A 119 ? ? -86.50 -70.00 119 5 ASP A 125 ? ? 89.13 -29.64 120 5 ARG A 136 ? ? 163.07 157.57 121 5 ILE A 137 ? ? 42.66 94.88 122 5 LYS A 153 ? ? 79.03 109.61 123 6 GLN A 14 ? ? 74.19 -57.19 124 6 SER A 22 ? ? 164.76 114.81 125 6 PRO A 23 ? ? -74.98 -160.91 126 6 GLU A 25 ? ? 160.51 152.02 127 6 THR A 39 ? ? 60.98 125.58 128 6 ASN A 48 ? ? -173.20 103.28 129 6 MET A 50 ? ? 169.56 38.25 130 6 GLU A 51 ? ? 37.05 55.71 131 6 ASP A 61 ? ? -142.91 -78.94 132 6 TRP A 62 ? ? 83.34 -72.89 133 6 ALA A 68 ? ? -105.65 -155.93 134 6 MET A 89 ? ? 63.72 153.47 135 6 ASP A 106 ? ? -114.72 78.20 136 6 GLU A 108 ? ? 48.44 -176.73 137 6 ARG A 109 ? ? -152.91 -66.66 138 6 GLN A 115 ? ? 55.98 170.49 139 6 ILE A 119 ? ? -86.88 -80.89 140 6 ALA A 124 ? ? -55.54 89.83 141 6 ASP A 125 ? ? 179.91 -159.09 142 6 GLU A 126 ? ? 68.76 -61.81 143 6 ARG A 136 ? ? 168.37 -67.23 144 6 ILE A 137 ? ? -52.91 109.89 145 6 PRO A 149 ? ? -75.10 -79.23 146 7 GLN A 14 ? ? 69.13 -58.86 147 7 ILE A 20 ? ? -150.78 29.79 148 7 SER A 22 ? ? 158.18 113.43 149 7 PRO A 23 ? ? -75.11 -159.66 150 7 GLU A 25 ? ? 163.73 137.73 151 7 GLU A 51 ? ? 165.34 -53.68 152 7 ASP A 61 ? ? 173.51 144.17 153 7 TRP A 62 ? ? -178.82 37.97 154 7 ALA A 68 ? ? -42.50 158.18 155 7 MET A 89 ? ? 62.63 -99.39 156 7 TYR A 101 ? ? -162.58 116.51 157 7 LYS A 107 ? ? 69.07 109.93 158 7 GLU A 108 ? ? 178.12 167.22 159 7 ARG A 109 ? ? 85.58 -43.22 160 7 ASP A 125 ? ? 79.61 -155.16 161 7 GLU A 126 ? ? 71.52 -63.71 162 7 ARG A 136 ? ? 169.46 177.46 163 7 ILE A 137 ? ? 49.62 98.72 164 7 LEU A 150 ? ? 175.88 58.77 165 7 LYS A 153 ? ? 77.14 149.56 166 8 ASN A 3 ? ? 178.16 110.13 167 8 GLN A 14 ? ? 45.46 106.92 168 8 SER A 22 ? ? 159.13 112.12 169 8 PRO A 23 ? ? -74.94 -157.80 170 8 GLU A 25 ? ? 161.46 138.40 171 8 THR A 39 ? ? 61.72 133.60 172 8 SER A 53 ? ? 39.33 85.68 173 8 ARG A 59 ? ? 66.47 131.86 174 8 THR A 60 ? ? -138.42 -74.25 175 8 ASP A 61 ? ? -124.43 -165.46 176 8 TRP A 62 ? ? -167.90 -157.91 177 8 ALA A 68 ? ? -54.75 -170.38 178 8 MET A 89 ? ? 63.97 -64.38 179 8 LYS A 107 ? ? 48.72 83.10 180 8 GLU A 108 ? ? -90.12 -95.98 181 8 ARG A 109 ? ? -159.60 30.66 182 8 ILE A 119 ? ? -104.93 -96.64 183 8 ALA A 124 ? ? -58.28 108.24 184 8 ASP A 125 ? ? 167.21 -37.59 185 8 SER A 127 ? ? -159.97 60.59 186 8 ARG A 136 ? ? 166.65 -169.93 187 8 ILE A 137 ? ? 43.70 91.23 188 8 LEU A 150 ? ? -172.16 116.61 189 8 LYS A 153 ? ? 71.46 138.92 190 9 ASN A 3 ? ? -45.88 169.61 191 9 GLN A 14 ? ? 68.35 -65.56 192 9 SER A 22 ? ? 160.40 112.97 193 9 PRO A 23 ? ? -75.04 -157.34 194 9 GLU A 25 ? ? 158.94 128.65 195 9 CYS A 47 ? ? -175.14 101.65 196 9 MET A 50 ? ? -106.97 -60.41 197 9 SER A 53 ? ? 53.42 98.06 198 9 VAL A 88 ? ? -39.90 -28.84 199 9 GLU A 94 ? ? -143.78 51.99 200 9 LYS A 107 ? ? -67.74 97.68 201 9 ARG A 109 ? ? 65.33 155.37 202 9 GLN A 115 ? ? 55.55 173.20 203 9 ILE A 119 ? ? -100.88 -82.23 204 9 ASP A 125 ? ? 170.43 -159.15 205 9 GLU A 126 ? ? 68.30 -62.39 206 9 ARG A 136 ? ? 176.44 86.26 207 9 ILE A 137 ? ? 66.43 156.79 208 9 LEU A 150 ? ? -178.98 38.86 209 9 LYS A 153 ? ? 59.17 -170.64 210 10 ASN A 3 ? ? -161.73 112.61 211 10 VAL A 13 ? ? -90.38 40.57 212 10 GLN A 14 ? ? -36.58 -31.76 213 10 GLU A 16 ? ? -60.04 -120.42 214 10 LEU A 17 ? ? 76.43 -10.73 215 10 ILE A 20 ? ? 174.87 -170.29 216 10 PRO A 23 ? ? -74.91 -160.47 217 10 GLU A 25 ? ? 159.06 137.07 218 10 CYS A 47 ? ? -170.10 105.80 219 10 GLU A 51 ? ? -161.78 116.06 220 10 SER A 53 ? ? 84.94 5.53 221 10 ASN A 55 ? ? -157.31 58.72 222 10 ASP A 61 ? ? 59.21 169.29 223 10 TRP A 62 ? ? -130.92 -64.03 224 10 ALA A 68 ? ? -64.43 -174.16 225 10 VAL A 71 ? ? -126.16 -161.09 226 10 VAL A 88 ? ? 67.82 -63.74 227 10 MET A 89 ? ? 86.01 -36.32 228 10 TYR A 101 ? ? -160.93 119.83 229 10 ARG A 109 ? ? 61.85 153.67 230 10 GLN A 115 ? ? 63.54 131.99 231 10 ILE A 119 ? ? -65.70 -73.02 232 10 ASP A 125 ? ? 167.15 -168.05 233 10 GLU A 126 ? ? 69.03 -60.19 234 10 ARG A 136 ? ? 162.21 -64.85 235 10 ILE A 137 ? ? -62.34 91.35 236 10 LYS A 153 ? ? 70.18 137.25 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LW8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LW8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.5 mM [U-99% 15N] protein-1, 10 mM potassium phosphate-2, 0.00002 mM sodium azide-3, 10%(v/v) D2O-4, 100%(v/v) H2O-5, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.5 ? mM '[U-99% 15N]' 1 'potassium phosphate-2' 10 ? mM ? 1 'sodium azide-3' 0.00002 ? mM ? 1 D2O-4 10 ? % ? 1 H2O-5 100 ? % ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_refine.entry_id 2LW8 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Braun and Wuthrich' 'structure solution' CYANA 1 ? ? refinement CYANA 2 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TRP N N N N 297 TRP CA C N S 298 TRP C C N N 299 TRP O O N N 300 TRP CB C N N 301 TRP CG C Y N 302 TRP CD1 C Y N 303 TRP CD2 C Y N 304 TRP NE1 N Y N 305 TRP CE2 C Y N 306 TRP CE3 C Y N 307 TRP CZ2 C Y N 308 TRP CZ3 C Y N 309 TRP CH2 C Y N 310 TRP OXT O N N 311 TRP H H N N 312 TRP H2 H N N 313 TRP HA H N N 314 TRP HB2 H N N 315 TRP HB3 H N N 316 TRP HD1 H N N 317 TRP HE1 H N N 318 TRP HE3 H N N 319 TRP HZ2 H N N 320 TRP HZ3 H N N 321 TRP HH2 H N N 322 TRP HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LW8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_