data_2LWL # _entry.id 2LWL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LWL RCSB RCSB102922 BMRB 18634 WWPDB D_1000102922 # _pdbx_database_related.db_id 18634 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LWL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-08-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'de Paula, V.S.' 1 'Gomes, N.S.F.' 2 'Lima, L.G.' 3 'Miyamoto, C.A.' 4 'Monteiro, R.Q.' 5 'Almeida, F.C.L.' 6 'Valente, A.' 7 # _citation.id primary _citation.title ;Structural Basis for the Interaction of Human beta-Defensin 6 and Its Putative Chemokine Receptor CCR2 and Breast Cancer Microvesicles. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 425 _citation.page_first 4479 _citation.page_last 4495 _citation.year 2013 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23938203 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2013.08.001 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'De Paula, V.S.' 1 primary 'Gomes, N.S.' 2 primary 'Lima, L.G.' 3 primary 'Miyamoto, C.A.' 4 primary 'Monteiro, R.Q.' 5 primary 'Almeida, F.C.' 6 primary 'Valente, A.P.' 7 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Beta-defensin 106' _entity.formula_weight 5444.380 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C40S _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Beta-defensin 6, BD-6, DEFB-6, Defensin, beta 106' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPSGSIID _entity_poly.pdbx_seq_one_letter_code_can GSHMFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPSGSIID _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 PHE n 1 6 PHE n 1 7 ASP n 1 8 GLU n 1 9 LYS n 1 10 CYS n 1 11 ASN n 1 12 LYS n 1 13 LEU n 1 14 LYS n 1 15 GLY n 1 16 THR n 1 17 CYS n 1 18 LYS n 1 19 ASN n 1 20 ASN n 1 21 CYS n 1 22 GLY n 1 23 LYS n 1 24 ASN n 1 25 GLU n 1 26 GLU n 1 27 LEU n 1 28 ILE n 1 29 ALA n 1 30 LEU n 1 31 CYS n 1 32 GLN n 1 33 LYS n 1 34 SER n 1 35 LEU n 1 36 LYS n 1 37 CYS n 1 38 CYS n 1 39 ARG n 1 40 THR n 1 41 ILE n 1 42 GLN n 1 43 PRO n 1 44 SER n 1 45 GLY n 1 46 SER n 1 47 ILE n 1 48 ILE n 1 49 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DEFB106A, BD6, DEFB106, DEFB6, DEFB106B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pet28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D106A_HUMAN _struct_ref.pdbx_db_accession Q8N104 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LWL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8N104 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 45 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LWL GLY A 1 ? UNP Q8N104 ? ? 'EXPRESSION TAG' -3 1 1 2LWL SER A 2 ? UNP Q8N104 ? ? 'EXPRESSION TAG' -2 2 1 2LWL HIS A 3 ? UNP Q8N104 ? ? 'EXPRESSION TAG' -1 3 1 2LWL MET A 4 ? UNP Q8N104 ? ? 'EXPRESSION TAG' 0 4 1 2LWL SER A 44 ? UNP Q8N104 CYS 60 'ENGINEERED MUTATION' 40 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY' 1 2 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 5 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.6 mM [U-99% 13C; U-99% 15N] sodium phosphate, 0.2-0.6 mM [U-99% 15N] sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 600 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LWL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LWL _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors 'Nilges, M.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name 'ARIA/CNS version' _pdbx_nmr_software.version 1.2 _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LWL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LWL _struct.title ;Structural Basis for the Interaction of Human β-Defensin 6 and Its Putative Chemokine Receptor CCR2 and Breast Cancer Microvesicles ; _struct.pdbx_descriptor 'Beta-defensin 106' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LWL _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'breast cancer, dynamic, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 13 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 1 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 9 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 10 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 37 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 6 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 33 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.994 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? LYS A 18 ? THR A 12 LYS A 14 A 2 LYS A 36 ? THR A 40 ? LYS A 32 THR A 36 A 3 GLU A 25 ? LEU A 30 ? GLU A 21 LEU A 26 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 16 ? N THR A 12 O CYS A 38 ? O CYS A 34 A 2 3 O CYS A 37 ? O CYS A 33 N ILE A 28 ? N ILE A 24 # _atom_sites.entry_id 2LWL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 HIS 3 -1 ? ? ? A . n A 1 4 MET 4 0 ? ? ? A . n A 1 5 PHE 5 1 1 PHE PHE A . n A 1 6 PHE 6 2 2 PHE PHE A . n A 1 7 ASP 7 3 3 ASP ASP A . n A 1 8 GLU 8 4 4 GLU GLU A . n A 1 9 LYS 9 5 5 LYS LYS A . n A 1 10 CYS 10 6 6 CYS CYS A . n A 1 11 ASN 11 7 7 ASN ASN A . n A 1 12 LYS 12 8 8 LYS LYS A . n A 1 13 LEU 13 9 9 LEU LEU A . n A 1 14 LYS 14 10 10 LYS LYS A . n A 1 15 GLY 15 11 11 GLY GLY A . n A 1 16 THR 16 12 12 THR THR A . n A 1 17 CYS 17 13 13 CYS CYS A . n A 1 18 LYS 18 14 14 LYS LYS A . n A 1 19 ASN 19 15 15 ASN ASN A . n A 1 20 ASN 20 16 16 ASN ASN A . n A 1 21 CYS 21 17 17 CYS CYS A . n A 1 22 GLY 22 18 18 GLY GLY A . n A 1 23 LYS 23 19 19 LYS LYS A . n A 1 24 ASN 24 20 20 ASN ASN A . n A 1 25 GLU 25 21 21 GLU GLU A . n A 1 26 GLU 26 22 22 GLU GLU A . n A 1 27 LEU 27 23 23 LEU LEU A . n A 1 28 ILE 28 24 24 ILE ILE A . n A 1 29 ALA 29 25 25 ALA ALA A . n A 1 30 LEU 30 26 26 LEU LEU A . n A 1 31 CYS 31 27 27 CYS CYS A . n A 1 32 GLN 32 28 28 GLN GLN A . n A 1 33 LYS 33 29 29 LYS LYS A . n A 1 34 SER 34 30 30 SER SER A . n A 1 35 LEU 35 31 31 LEU LEU A . n A 1 36 LYS 36 32 32 LYS LYS A . n A 1 37 CYS 37 33 33 CYS CYS A . n A 1 38 CYS 38 34 34 CYS CYS A . n A 1 39 ARG 39 35 35 ARG ARG A . n A 1 40 THR 40 36 36 THR THR A . n A 1 41 ILE 41 37 37 ILE ILE A . n A 1 42 GLN 42 38 38 GLN GLN A . n A 1 43 PRO 43 39 39 PRO PRO A . n A 1 44 SER 44 40 40 SER SER A . n A 1 45 GLY 45 41 41 GLY GLY A . n A 1 46 SER 46 42 42 SER SER A . n A 1 47 ILE 47 43 43 ILE ILE A . n A 1 48 ILE 48 44 44 ILE ILE A . n A 1 49 ASP 49 45 45 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-21 2 'Structure model' 1 1 2013-09-11 3 'Structure model' 1 2 2013-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 0.6 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' ? 0.2-0.6 mM '[U-99% 15N]' 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 O A LYS 29 ? ? HG A SER 30 ? ? 1.57 2 14 O A LYS 29 ? ? HG A SER 30 ? ? 1.58 3 15 O A LYS 29 ? ? HG A SER 30 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 10 ? ? 70.97 30.47 2 1 ASN A 20 ? ? 58.28 17.25 3 1 SER A 40 ? ? 80.77 -47.18 4 1 ILE A 43 ? ? 38.48 -114.57 5 2 ILE A 43 ? ? 78.22 -15.09 6 2 ILE A 44 ? ? -144.17 -51.27 7 3 SER A 42 ? ? 69.04 -177.29 8 3 ILE A 43 ? ? 73.77 -61.96 9 3 ILE A 44 ? ? -170.18 148.51 10 4 SER A 42 ? ? 69.19 123.39 11 4 ILE A 43 ? ? 76.99 132.08 12 4 ILE A 44 ? ? 44.15 97.28 13 5 SER A 40 ? ? 74.77 -2.78 14 5 ILE A 43 ? ? 76.44 -42.38 15 6 ILE A 37 ? ? -62.19 99.93 16 6 PRO A 39 ? ? -38.21 146.51 17 6 SER A 42 ? ? 72.37 165.15 18 6 ILE A 43 ? ? 68.89 -74.48 19 7 SER A 40 ? ? -135.06 -145.27 20 7 SER A 42 ? ? 60.51 -144.80 21 7 ILE A 43 ? ? -79.86 -82.57 22 8 ILE A 43 ? ? 71.70 -66.23 23 9 SER A 42 ? ? 65.46 -171.77 24 9 ILE A 43 ? ? 68.99 -72.10 25 10 SER A 42 ? ? 62.71 -145.03 26 11 SER A 30 ? ? 80.97 -4.20 27 11 SER A 42 ? ? 65.60 159.45 28 11 ILE A 43 ? ? 74.32 -66.68 29 12 SER A 40 ? ? 73.64 -61.64 30 12 SER A 42 ? ? 42.01 -114.60 31 12 ILE A 43 ? ? -140.37 -88.23 32 13 ILE A 24 ? ? -130.93 -30.26 33 13 PRO A 39 ? ? -58.94 -171.19 34 13 SER A 42 ? ? 55.38 -168.08 35 14 SER A 40 ? ? 179.29 161.10 36 14 SER A 42 ? ? 64.61 -150.86 37 14 ILE A 43 ? ? 75.34 -78.19 38 15 SER A 40 ? ? -165.50 -167.57 39 15 SER A 42 ? ? 39.14 80.80 40 15 ILE A 43 ? ? 33.37 -97.06 41 16 LYS A 29 ? ? 59.54 14.53 42 16 SER A 40 ? ? 70.53 165.21 43 16 SER A 42 ? ? 167.63 143.93 44 16 ILE A 43 ? ? 70.69 -57.14 45 17 LYS A 10 ? ? 71.41 43.96 46 17 LYS A 19 ? ? -41.48 109.56 47 17 SER A 30 ? ? 77.92 -1.57 48 17 SER A 40 ? ? 72.25 123.33 49 17 ILE A 43 ? ? 73.42 -50.48 50 18 ILE A 37 ? ? -67.73 99.87 51 18 SER A 42 ? ? 69.77 177.89 52 18 ILE A 43 ? ? 71.76 -58.05 53 19 SER A 40 ? ? 177.69 165.48 54 19 SER A 42 ? ? 61.04 -149.10 55 19 ILE A 43 ? ? 75.05 -55.15 56 20 ILE A 43 ? ? 74.90 -64.54 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A HIS -1 ? A HIS 3 4 1 Y 1 A MET 0 ? A MET 4 5 2 Y 1 A GLY -3 ? A GLY 1 6 2 Y 1 A SER -2 ? A SER 2 7 2 Y 1 A HIS -1 ? A HIS 3 8 2 Y 1 A MET 0 ? A MET 4 9 3 Y 1 A GLY -3 ? A GLY 1 10 3 Y 1 A SER -2 ? A SER 2 11 3 Y 1 A HIS -1 ? A HIS 3 12 3 Y 1 A MET 0 ? A MET 4 13 4 Y 1 A GLY -3 ? A GLY 1 14 4 Y 1 A SER -2 ? A SER 2 15 4 Y 1 A HIS -1 ? A HIS 3 16 4 Y 1 A MET 0 ? A MET 4 17 5 Y 1 A GLY -3 ? A GLY 1 18 5 Y 1 A SER -2 ? A SER 2 19 5 Y 1 A HIS -1 ? A HIS 3 20 5 Y 1 A MET 0 ? A MET 4 21 6 Y 1 A GLY -3 ? A GLY 1 22 6 Y 1 A SER -2 ? A SER 2 23 6 Y 1 A HIS -1 ? A HIS 3 24 6 Y 1 A MET 0 ? A MET 4 25 7 Y 1 A GLY -3 ? A GLY 1 26 7 Y 1 A SER -2 ? A SER 2 27 7 Y 1 A HIS -1 ? A HIS 3 28 7 Y 1 A MET 0 ? A MET 4 29 8 Y 1 A GLY -3 ? A GLY 1 30 8 Y 1 A SER -2 ? A SER 2 31 8 Y 1 A HIS -1 ? A HIS 3 32 8 Y 1 A MET 0 ? A MET 4 33 9 Y 1 A GLY -3 ? A GLY 1 34 9 Y 1 A SER -2 ? A SER 2 35 9 Y 1 A HIS -1 ? A HIS 3 36 9 Y 1 A MET 0 ? A MET 4 37 10 Y 1 A GLY -3 ? A GLY 1 38 10 Y 1 A SER -2 ? A SER 2 39 10 Y 1 A HIS -1 ? A HIS 3 40 10 Y 1 A MET 0 ? A MET 4 41 11 Y 1 A GLY -3 ? A GLY 1 42 11 Y 1 A SER -2 ? A SER 2 43 11 Y 1 A HIS -1 ? A HIS 3 44 11 Y 1 A MET 0 ? A MET 4 45 12 Y 1 A GLY -3 ? A GLY 1 46 12 Y 1 A SER -2 ? A SER 2 47 12 Y 1 A HIS -1 ? A HIS 3 48 12 Y 1 A MET 0 ? A MET 4 49 13 Y 1 A GLY -3 ? A GLY 1 50 13 Y 1 A SER -2 ? A SER 2 51 13 Y 1 A HIS -1 ? A HIS 3 52 13 Y 1 A MET 0 ? A MET 4 53 14 Y 1 A GLY -3 ? A GLY 1 54 14 Y 1 A SER -2 ? A SER 2 55 14 Y 1 A HIS -1 ? A HIS 3 56 14 Y 1 A MET 0 ? A MET 4 57 15 Y 1 A GLY -3 ? A GLY 1 58 15 Y 1 A SER -2 ? A SER 2 59 15 Y 1 A HIS -1 ? A HIS 3 60 15 Y 1 A MET 0 ? A MET 4 61 16 Y 1 A GLY -3 ? A GLY 1 62 16 Y 1 A SER -2 ? A SER 2 63 16 Y 1 A HIS -1 ? A HIS 3 64 16 Y 1 A MET 0 ? A MET 4 65 17 Y 1 A GLY -3 ? A GLY 1 66 17 Y 1 A SER -2 ? A SER 2 67 17 Y 1 A HIS -1 ? A HIS 3 68 17 Y 1 A MET 0 ? A MET 4 69 18 Y 1 A GLY -3 ? A GLY 1 70 18 Y 1 A SER -2 ? A SER 2 71 18 Y 1 A HIS -1 ? A HIS 3 72 18 Y 1 A MET 0 ? A MET 4 73 19 Y 1 A GLY -3 ? A GLY 1 74 19 Y 1 A SER -2 ? A SER 2 75 19 Y 1 A HIS -1 ? A HIS 3 76 19 Y 1 A MET 0 ? A MET 4 77 20 Y 1 A GLY -3 ? A GLY 1 78 20 Y 1 A SER -2 ? A SER 2 79 20 Y 1 A HIS -1 ? A HIS 3 80 20 Y 1 A MET 0 ? A MET 4 #