data_2LX9 # _entry.id 2LX9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LX9 pdb_00002lx9 10.2210/pdb2lx9/pdb RCSB RCSB102946 ? ? BMRB 18668 ? 10.13018/BMR18668 WWPDB D_1000102946 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-14 2 'Structure model' 1 1 2012-12-26 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LX9 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-08-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18668 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lau, C.K.Y.' 1 'Ishida, H.' 2 'Liu, Z.' 3 'Vogel, H.J.' 4 # _citation.id primary _citation.title 'Solution Structure of Escherichia coli FeoA and Its Potential Role in Bacterial Ferrous Iron Transport.' _citation.journal_abbrev J.Bacteriol. _citation.journal_volume 195 _citation.page_first 46 _citation.page_last 55 _citation.year 2013 _citation.journal_id_ASTM JOBAAY _citation.country US _citation.journal_id_ISSN 0021-9193 _citation.journal_id_CSD 0767 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23104801 _citation.pdbx_database_id_DOI 10.1128/JB.01121-12 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lau, C.K.' 1 ? primary 'Ishida, H.' 2 ? primary 'Liu, Z.' 3 ? primary 'Vogel, H.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ferrous iron transport protein A' _entity.formula_weight 9436.902 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C75S _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSSLEHHH HHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSSLEHHH HHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 TYR n 1 4 THR n 1 5 PRO n 1 6 ASP n 1 7 THR n 1 8 ALA n 1 9 TRP n 1 10 LYS n 1 11 ILE n 1 12 THR n 1 13 GLY n 1 14 PHE n 1 15 SER n 1 16 ARG n 1 17 GLU n 1 18 ILE n 1 19 SER n 1 20 PRO n 1 21 ALA n 1 22 TYR n 1 23 ARG n 1 24 GLN n 1 25 LYS n 1 26 LEU n 1 27 LEU n 1 28 SER n 1 29 LEU n 1 30 GLY n 1 31 MET n 1 32 LEU n 1 33 PRO n 1 34 GLY n 1 35 SER n 1 36 SER n 1 37 PHE n 1 38 ASN n 1 39 VAL n 1 40 VAL n 1 41 ARG n 1 42 VAL n 1 43 ALA n 1 44 PRO n 1 45 LEU n 1 46 GLY n 1 47 ASP n 1 48 PRO n 1 49 ILE n 1 50 HIS n 1 51 ILE n 1 52 GLU n 1 53 THR n 1 54 ARG n 1 55 ARG n 1 56 VAL n 1 57 SER n 1 58 LEU n 1 59 VAL n 1 60 LEU n 1 61 ARG n 1 62 LYS n 1 63 LYS n 1 64 ASP n 1 65 LEU n 1 66 ALA n 1 67 LEU n 1 68 LEU n 1 69 GLU n 1 70 VAL n 1 71 GLU n 1 72 ALA n 1 73 VAL n 1 74 SER n 1 75 SER n 1 76 LEU n 1 77 GLU n 1 78 HIS n 1 79 HIS n 1 80 HIS n 1 81 HIS n 1 82 HIS n 1 83 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'b3408, feoA, JW3371' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 HIS 83 83 83 HIS HIS A . n # _cell.entry_id 2LX9 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2LX9 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LX9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LX9 _struct.title 'Solution Structure of Escherichia coli Ferrous Iron transport protein A (FeoA)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LX9 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'FeoA, TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FEOA_ECOLI _struct_ref.pdbx_db_accession P0AEL3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSC _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LX9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AEL3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LX9 SER A 75 ? UNP P0AEL3 CYS 75 'engineered mutation' 75 1 1 2LX9 LEU A 76 ? UNP P0AEL3 ? ? 'expression tag' 76 2 1 2LX9 GLU A 77 ? UNP P0AEL3 ? ? 'expression tag' 77 3 1 2LX9 HIS A 78 ? UNP P0AEL3 ? ? 'expression tag' 78 4 1 2LX9 HIS A 79 ? UNP P0AEL3 ? ? 'expression tag' 79 5 1 2LX9 HIS A 80 ? UNP P0AEL3 ? ? 'expression tag' 80 6 1 2LX9 HIS A 81 ? UNP P0AEL3 ? ? 'expression tag' 81 7 1 2LX9 HIS A 82 ? UNP P0AEL3 ? ? 'expression tag' 82 8 1 2LX9 HIS A 83 ? UNP P0AEL3 ? ? 'expression tag' 83 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? LEU A 29 ? SER A 19 LEU A 29 1 ? 11 HELX_P HELX_P2 2 ARG A 61 ? LEU A 68 ? ARG A 61 LEU A 68 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 57 ? LEU A 60 ? SER A 57 LEU A 60 A 2 ILE A 49 ? GLU A 52 ? ILE A 49 GLU A 52 A 3 SER A 36 ? VAL A 42 ? SER A 36 VAL A 42 A 4 ALA A 8 ? GLY A 13 ? ALA A 8 GLY A 13 A 5 GLU A 69 ? ALA A 72 ? GLU A 69 ALA A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 60 ? O LEU A 60 N ILE A 49 ? N ILE A 49 A 2 3 O GLU A 52 ? O GLU A 52 N ASN A 38 ? N ASN A 38 A 3 4 O PHE A 37 ? O PHE A 37 N TRP A 9 ? N TRP A 9 A 4 5 N LYS A 10 ? N LYS A 10 O GLU A 71 ? O GLU A 71 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 16 H A ILE 49 ? ? O A LEU 60 ? ? 1.59 2 21 H A ILE 49 ? ? O A LEU 60 ? ? 1.59 3 23 HG1 A THR 53 ? ? H A VAL 56 ? ? 1.25 4 24 H A ILE 49 ? ? O A LEU 60 ? ? 1.59 5 25 H A ILE 49 ? ? O A LEU 60 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 33 ? ? -43.47 177.29 2 1 PRO A 48 ? ? -57.93 175.42 3 1 SER A 74 ? ? -150.21 11.88 4 1 LEU A 76 ? ? 49.18 87.87 5 2 MET A 31 ? ? -64.60 74.18 6 2 PRO A 33 ? ? -49.67 -164.34 7 2 SER A 35 ? ? -138.63 -156.28 8 2 ARG A 55 ? ? -142.93 32.44 9 2 HIS A 79 ? ? 44.97 79.02 10 2 HIS A 81 ? ? 44.59 96.60 11 3 PRO A 33 ? ? -45.11 178.64 12 3 SER A 35 ? ? -141.31 -157.05 13 3 PRO A 48 ? ? -57.57 170.09 14 3 ARG A 55 ? ? -142.53 31.67 15 3 SER A 75 ? ? 38.60 80.79 16 3 GLU A 77 ? ? 42.63 76.05 17 3 HIS A 78 ? ? 41.27 -164.16 18 4 GLN A 2 ? ? -150.35 -7.94 19 4 MET A 31 ? ? -108.81 74.82 20 4 PRO A 33 ? ? -42.65 179.31 21 4 PRO A 48 ? ? -66.26 -175.03 22 4 GLU A 77 ? ? 35.59 52.87 23 4 HIS A 79 ? ? 43.12 -92.07 24 4 HIS A 80 ? ? 47.51 71.66 25 4 HIS A 82 ? ? 48.39 -108.45 26 5 MET A 31 ? ? -61.13 73.67 27 5 PRO A 33 ? ? -46.52 -178.56 28 5 SER A 74 ? ? 46.69 28.64 29 5 HIS A 78 ? ? -151.49 64.01 30 5 HIS A 79 ? ? -101.25 53.19 31 5 HIS A 80 ? ? -157.51 81.26 32 5 HIS A 81 ? ? 44.22 -114.21 33 5 HIS A 82 ? ? 43.31 -168.69 34 6 PRO A 33 ? ? -49.38 -169.15 35 6 PRO A 48 ? ? -65.53 -173.12 36 6 ARG A 54 ? ? -38.46 -35.70 37 6 LEU A 76 ? ? -164.02 55.32 38 6 HIS A 79 ? ? 39.85 25.91 39 7 GLN A 2 ? ? 48.93 -92.86 40 7 MET A 31 ? ? -67.26 73.45 41 7 PRO A 33 ? ? -48.63 -168.99 42 7 SER A 35 ? ? -139.54 -156.65 43 7 SER A 74 ? ? -90.12 40.12 44 7 GLU A 77 ? ? 45.45 96.74 45 7 HIS A 79 ? ? -63.64 -90.65 46 7 HIS A 80 ? ? -161.09 -67.41 47 8 MET A 31 ? ? -67.78 73.60 48 8 PRO A 33 ? ? -46.03 -179.03 49 8 PRO A 48 ? ? -57.23 172.06 50 8 VAL A 73 ? ? -82.11 37.93 51 8 HIS A 79 ? ? 54.45 -81.00 52 9 PRO A 33 ? ? -37.91 162.39 53 9 SER A 35 ? ? -129.30 -156.66 54 9 PRO A 48 ? ? -59.84 173.46 55 9 SER A 74 ? ? -169.03 73.24 56 9 GLU A 77 ? ? 58.18 152.14 57 9 HIS A 78 ? ? -59.92 -111.47 58 9 HIS A 82 ? ? 42.61 91.87 59 10 PRO A 33 ? ? -48.47 -171.11 60 10 SER A 35 ? ? -139.24 -156.83 61 10 PRO A 48 ? ? -57.05 173.15 62 10 GLU A 77 ? ? -41.34 158.81 63 10 HIS A 79 ? ? 55.06 163.33 64 10 HIS A 80 ? ? -133.08 -99.71 65 11 GLN A 2 ? ? -147.21 -30.16 66 11 MET A 31 ? ? -111.65 73.08 67 11 PRO A 33 ? ? -39.62 167.86 68 11 LEU A 45 ? ? -55.09 -3.84 69 11 PRO A 48 ? ? -59.95 177.54 70 11 ARG A 55 ? ? -143.04 31.41 71 11 GLU A 77 ? ? 47.79 -172.26 72 11 HIS A 78 ? ? -153.26 -54.68 73 12 GLN A 2 ? ? -74.47 -101.58 74 12 PRO A 33 ? ? -48.74 -168.49 75 12 SER A 35 ? ? -136.12 -158.11 76 12 ARG A 41 ? ? -173.23 147.26 77 12 PRO A 48 ? ? -54.81 175.24 78 12 SER A 74 ? ? -147.79 -44.21 79 12 GLU A 77 ? ? 56.27 156.75 80 12 HIS A 79 ? ? -53.38 -77.93 81 13 GLN A 2 ? ? -72.65 -70.39 82 13 PRO A 33 ? ? -44.33 176.69 83 13 SER A 35 ? ? -134.48 -155.85 84 13 LEU A 76 ? ? -61.24 -84.61 85 13 GLU A 77 ? ? -164.36 -72.25 86 14 MET A 31 ? ? -112.80 74.01 87 14 PRO A 33 ? ? -40.12 169.15 88 14 LEU A 45 ? ? -52.99 -5.72 89 14 PRO A 48 ? ? -54.51 -171.90 90 14 GLU A 77 ? ? 57.41 96.04 91 15 PRO A 33 ? ? -40.77 169.14 92 15 SER A 35 ? ? -103.36 -169.44 93 15 LEU A 45 ? ? -51.58 -5.16 94 15 PRO A 48 ? ? -52.96 -170.74 95 15 ARG A 54 ? ? -39.05 -24.74 96 15 SER A 74 ? ? -153.83 -33.45 97 15 HIS A 82 ? ? -73.66 -123.39 98 16 PRO A 33 ? ? -48.60 -170.64 99 16 PRO A 48 ? ? -64.13 -179.14 100 16 ARG A 55 ? ? -142.03 31.68 101 16 HIS A 81 ? ? 53.48 88.39 102 17 MET A 31 ? ? -118.49 75.66 103 17 PRO A 33 ? ? -40.56 175.90 104 17 SER A 35 ? ? -140.80 -156.37 105 17 LEU A 45 ? ? -60.14 5.71 106 17 VAL A 56 ? ? -170.05 -179.90 107 17 SER A 74 ? ? -157.22 1.81 108 17 HIS A 81 ? ? -157.51 -35.43 109 17 HIS A 82 ? ? 47.02 -90.33 110 18 GLN A 2 ? ? -144.68 -50.64 111 18 PRO A 33 ? ? -50.00 -165.88 112 18 LEU A 45 ? ? -53.73 2.00 113 18 PRO A 48 ? ? -57.99 170.46 114 18 VAL A 73 ? ? -82.98 -80.65 115 18 SER A 74 ? ? 41.49 16.80 116 18 HIS A 78 ? ? 44.51 -109.81 117 18 HIS A 79 ? ? -146.73 -97.23 118 18 HIS A 80 ? ? -154.84 -67.23 119 18 HIS A 82 ? ? -69.58 -75.51 120 19 PRO A 33 ? ? -43.40 177.54 121 19 SER A 74 ? ? -148.12 -61.55 122 19 LEU A 76 ? ? 58.32 97.13 123 19 HIS A 80 ? ? -158.71 86.93 124 19 HIS A 81 ? ? 50.07 86.64 125 20 MET A 31 ? ? -108.71 73.92 126 20 PRO A 33 ? ? -42.48 176.67 127 20 SER A 35 ? ? -136.94 -156.93 128 20 PRO A 48 ? ? -56.56 175.70 129 20 ARG A 54 ? ? -39.08 -36.76 130 20 SER A 74 ? ? -142.42 -19.97 131 21 GLN A 2 ? ? -74.10 -90.40 132 21 PRO A 33 ? ? -41.88 171.60 133 21 SER A 35 ? ? -96.11 -156.68 134 21 PRO A 48 ? ? -61.46 -170.94 135 21 VAL A 73 ? ? -76.78 -76.90 136 21 SER A 74 ? ? 39.71 22.55 137 21 GLU A 77 ? ? -48.03 -75.22 138 21 HIS A 78 ? ? 44.94 -162.51 139 21 HIS A 79 ? ? 49.34 92.16 140 22 MET A 31 ? ? -66.85 73.70 141 22 PRO A 33 ? ? -49.96 -166.02 142 22 PRO A 48 ? ? -55.71 173.72 143 22 ARG A 55 ? ? -142.93 32.29 144 22 GLU A 77 ? ? 49.64 100.79 145 22 HIS A 79 ? ? -168.57 83.67 146 23 MET A 31 ? ? -108.82 72.11 147 23 PRO A 33 ? ? -41.96 175.51 148 23 LEU A 45 ? ? -61.83 4.91 149 23 SER A 74 ? ? -162.62 9.45 150 23 GLU A 77 ? ? -47.15 -17.52 151 24 MET A 31 ? ? -109.39 75.78 152 24 PRO A 33 ? ? -40.34 172.22 153 24 SER A 35 ? ? -137.20 -157.52 154 24 PRO A 48 ? ? -62.70 -178.19 155 24 ARG A 54 ? ? -38.85 -37.30 156 24 VAL A 56 ? ? -171.73 -179.59 157 24 SER A 74 ? ? -149.49 -66.08 158 24 GLU A 77 ? ? 51.71 95.76 159 25 MET A 31 ? ? -61.89 73.85 160 25 PRO A 33 ? ? -50.19 -160.75 161 25 SER A 35 ? ? -142.41 -156.53 162 25 PRO A 48 ? ? -53.87 -173.80 163 26 GLN A 2 ? ? 51.84 -86.85 164 26 MET A 31 ? ? -108.48 75.83 165 26 PRO A 33 ? ? -42.20 177.89 166 26 ARG A 54 ? ? -43.13 -18.96 167 26 SER A 74 ? ? -154.85 40.66 168 26 HIS A 78 ? ? 43.57 -101.94 169 26 HIS A 79 ? ? 54.52 165.78 170 27 MET A 31 ? ? -69.89 73.99 171 27 PRO A 33 ? ? -44.11 176.81 172 27 SER A 35 ? ? -138.35 -156.16 173 27 PRO A 48 ? ? -58.45 175.39 174 27 SER A 74 ? ? -88.65 -85.15 175 27 GLU A 77 ? ? 56.26 -106.10 176 27 HIS A 78 ? ? 44.29 98.48 177 27 HIS A 80 ? ? 49.58 89.03 178 28 PRO A 33 ? ? -44.76 -179.85 179 28 SER A 35 ? ? -144.33 -157.76 180 28 PRO A 48 ? ? -64.28 -177.88 181 28 LYS A 62 ? ? -35.22 -35.18 182 28 SER A 74 ? ? -160.21 -28.14 183 29 GLN A 2 ? ? 55.14 -83.78 184 29 MET A 31 ? ? -69.48 76.29 185 29 PRO A 33 ? ? -46.50 -178.03 186 29 SER A 35 ? ? -138.03 -158.25 187 29 PRO A 48 ? ? -59.11 171.70 188 29 VAL A 73 ? ? -65.06 -149.12 189 30 MET A 31 ? ? -61.55 73.96 190 30 PRO A 33 ? ? -47.69 -177.43 191 30 SER A 35 ? ? -101.18 -169.60 192 30 LEU A 45 ? ? -53.00 -6.69 193 30 PRO A 48 ? ? -58.06 -170.29 194 30 ARG A 54 ? ? -39.04 -35.39 195 30 LEU A 76 ? ? -91.97 54.70 196 30 HIS A 79 ? ? -75.75 -152.91 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LX9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.039 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.002 _pdbx_nmr_ensemble_rms.entry_id 2LX9 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LX9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '20 mM HEPES, 1 mM DSS, 100 mM sodium chloride, 0.8 mM [U-95% 13C; U-95% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HEPES-1 20 ? mM ? 1 DSS-2 1 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 entity-4 0.8 ? mM '[U-95% 13C; U-95% 15N]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LX9 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 40 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1197 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 297 _pdbx_nmr_constraints.NOE_long_range_total_count 357 _pdbx_nmr_constraints.NOE_medium_range_total_count 192 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 351 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LX9 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.26 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LX9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_