data_2LXK # _entry.id 2LXK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LXK pdb_00002lxk 10.2210/pdb2lxk/pdb RCSB RCSB102957 ? ? BMRB 18680 ? ? WWPDB D_1000102957 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18679 BMRB unspecified . 2LXJ PDB unspecified . 18680 BMRB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LXK _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-08-27 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, J.' 1 'Jeong, K.' 2 'Kim, Y.' 3 # _citation.id primary _citation.title 'Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium' _citation.journal_abbrev Biochemistry _citation.journal_volume 52 _citation.page_first 2492 _citation.page_last 2504 _citation.year 2013 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23506337 _citation.pdbx_database_id_DOI 10.1021/bi301641b # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, J.' 1 ? primary 'Jeong, K.' 2 ? primary 'Jin, B.' 3 ? primary 'Ryu, K.' 4 ? primary 'Kim, E.H.' 5 ? primary 'Ahn, J.H.' 6 ? primary 'Kim, Y.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cold shock-like protein CspLA' _entity.formula_weight 7272.875 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CspL # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA _entity_poly.pdbx_seq_one_letter_code_can MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLN n 1 4 GLY n 1 5 THR n 1 6 VAL n 1 7 LYS n 1 8 TRP n 1 9 PHE n 1 10 ASN n 1 11 ALA n 1 12 GLU n 1 13 LYS n 1 14 GLY n 1 15 PHE n 1 16 GLY n 1 17 PHE n 1 18 ILE n 1 19 GLU n 1 20 ARG n 1 21 GLU n 1 22 ASN n 1 23 GLY n 1 24 ASP n 1 25 ASP n 1 26 VAL n 1 27 PHE n 1 28 VAL n 1 29 HIS n 1 30 PHE n 1 31 SER n 1 32 ALA n 1 33 ILE n 1 34 GLN n 1 35 GLY n 1 36 ASP n 1 37 GLY n 1 38 PHE n 1 39 LYS n 1 40 SER n 1 41 LEU n 1 42 ASP n 1 43 GLU n 1 44 GLY n 1 45 GLN n 1 46 ALA n 1 47 VAL n 1 48 THR n 1 49 PHE n 1 50 ASP n 1 51 VAL n 1 52 GLU n 1 53 GLU n 1 54 GLY n 1 55 GLN n 1 56 ARG n 1 57 GLY n 1 58 PRO n 1 59 GLN n 1 60 ALA n 1 61 ALA n 1 62 ASN n 1 63 VAL n 1 64 GLN n 1 65 LYS n 1 66 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cspLA, cspA, cspL, lmo1364' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-679 / EGD-e' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 169963 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-11a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CSPA_LISMO _struct_ref.pdbx_db_accession P0A355 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LXK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A355 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D CBCA(CO)NH' 1 2 1 '3D HNCO' 1 3 1 '3D HNCACB' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HNHA' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D HN(CO)CA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.8mM [U-13C; U-15N] entity-1, 50mM potassium phosphate-2, 0.1mM EDTA-3, 100mM potassium chloride-4, 0.004v/v DSS-5, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LXK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'CNS water refinement' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LXK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LXK _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'chemical shift calculation' CYANA 1 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'chemical shift calculation' CYANA 3 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CYANA 4 ? ? refinement CNS 5 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LXK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LXK _struct.title 'Backbone 1H, 13C, and 15N Chemical Shift Assignments for cold shock protein, LmCsp' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LXK _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Protein, Nucleic Acids, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 2 ? ASN A 10 ? GLU A 2 ASN A 10 A 2 PHE A 15 ? GLU A 19 ? PHE A 15 GLU A 19 A 3 VAL A 26 ? VAL A 28 ? VAL A 26 VAL A 28 A 4 GLY A 57 ? LYS A 65 ? GLY A 57 LYS A 65 A 5 ALA A 46 ? GLY A 54 ? ALA A 46 GLY A 54 A 6 GLU A 2 ? ASN A 10 ? GLU A 2 ASN A 10 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 8 ? N TRP A 8 O PHE A 17 ? O PHE A 17 A 2 3 N GLY A 16 ? N GLY A 16 O VAL A 28 ? O VAL A 28 A 3 4 N PHE A 27 ? N PHE A 27 O ALA A 60 ? O ALA A 60 A 4 5 O GLY A 57 ? O GLY A 57 N GLY A 54 ? N GLY A 54 A 5 6 O VAL A 47 ? O VAL A 47 N GLY A 4 ? N GLY A 4 # _atom_sites.entry_id 2LXK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-07 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.8 ? mM '[U-13C; U-15N]' 1 'potassium phosphate-2' 50 ? mM ? 1 EDTA-3 0.1 ? mM ? 1 'potassium chloride-4' 100 ? mM ? 1 DSS-5 0.004 ? v/v ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE1 A GLU 12 ? ? HZ1 A LYS 13 ? ? 1.57 2 5 HD22 A ASN 10 ? ? HB2 A PHE 15 ? ? 1.22 3 7 OE1 A GLU 2 ? ? HH12 A ARG 20 ? ? 1.58 4 10 HD21 A ASN 10 ? ? HB2 A LYS 13 ? ? 1.24 5 14 OE1 A GLU 2 ? ? HH11 A ARG 20 ? ? 1.59 6 19 HB2 A GLU 52 ? ? HG3 A GLN 59 ? ? 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 24 ? ? -98.88 55.47 2 1 ASP A 25 ? ? -164.17 44.29 3 1 ARG A 56 ? ? 52.57 81.87 4 1 ASN A 62 ? ? 58.93 83.91 5 2 TRP A 8 ? ? 176.99 168.00 6 2 ASN A 10 ? ? -68.57 84.06 7 2 ASP A 25 ? ? 63.45 72.93 8 2 ASP A 36 ? ? 73.46 -47.41 9 2 ASN A 62 ? ? 59.86 88.57 10 3 ASP A 24 ? ? -99.41 56.63 11 3 GLN A 55 ? ? -47.40 -74.11 12 3 ASN A 62 ? ? 56.87 88.60 13 4 TRP A 8 ? ? -178.28 141.06 14 4 ASN A 10 ? ? -68.56 87.24 15 4 ASP A 24 ? ? -96.60 56.87 16 4 ASP A 25 ? ? -150.21 39.33 17 4 ARG A 56 ? ? -122.51 -63.05 18 4 ASN A 62 ? ? 59.52 89.26 19 5 ASP A 24 ? ? -91.67 57.77 20 5 ASP A 25 ? ? -161.93 78.34 21 5 ASP A 36 ? ? 69.03 89.40 22 5 ARG A 56 ? ? -144.17 -64.79 23 5 ASN A 62 ? ? 56.66 85.52 24 6 TRP A 8 ? ? 176.42 151.19 25 6 ASN A 10 ? ? -60.87 98.59 26 6 ALA A 11 ? ? -48.22 -10.65 27 6 ASP A 24 ? ? -98.98 58.87 28 6 ASP A 36 ? ? -113.52 -77.24 29 6 ARG A 56 ? ? -117.66 -162.26 30 6 ASN A 62 ? ? 62.48 98.78 31 7 ASN A 10 ? ? -68.47 93.10 32 7 ASP A 25 ? ? -170.07 26.50 33 7 ASN A 62 ? ? 51.66 76.40 34 8 GLU A 2 ? ? -100.02 -158.94 35 8 ASP A 24 ? ? -93.95 58.30 36 8 ASP A 25 ? ? -161.44 44.80 37 8 ASP A 36 ? ? 72.49 115.01 38 8 ASN A 62 ? ? 54.34 93.53 39 9 TRP A 8 ? ? -176.24 142.82 40 9 ASP A 25 ? ? 63.75 85.39 41 9 ARG A 56 ? ? -137.52 -52.39 42 9 ASN A 62 ? ? 61.48 88.35 43 10 ASP A 24 ? ? -98.60 57.62 44 10 ASP A 36 ? ? 71.87 -56.40 45 10 ARG A 56 ? ? 171.73 -26.74 46 10 ASN A 62 ? ? 58.84 94.44 47 11 ASP A 24 ? ? -115.24 58.08 48 11 ASP A 25 ? ? -152.48 30.35 49 11 ARG A 56 ? ? -150.93 -54.01 50 11 ASN A 62 ? ? 23.24 101.59 51 12 PHE A 30 ? ? -67.51 5.14 52 12 ASN A 62 ? ? 64.39 91.22 53 13 ASN A 10 ? ? -68.68 89.76 54 13 ASP A 25 ? ? 54.28 77.94 55 13 ASP A 36 ? ? -112.67 79.53 56 13 ASN A 62 ? ? 51.92 90.68 57 14 TRP A 8 ? ? -178.46 140.64 58 14 ASP A 25 ? ? 63.94 99.40 59 14 ASP A 36 ? ? 71.32 -40.02 60 14 LYS A 39 ? ? -174.28 -30.96 61 14 ARG A 56 ? ? -155.45 -54.27 62 14 ASN A 62 ? ? 55.17 97.47 63 15 ASP A 36 ? ? 68.20 98.74 64 15 LYS A 39 ? ? -149.50 20.24 65 15 GLN A 55 ? ? -80.17 40.16 66 15 ARG A 56 ? ? 179.33 -27.30 67 15 ASN A 62 ? ? 55.73 90.38 68 16 TRP A 8 ? ? -178.61 139.44 69 16 ASN A 10 ? ? -69.00 81.14 70 16 ASP A 24 ? ? -95.86 56.73 71 16 GLN A 34 ? ? -117.51 -169.60 72 16 ARG A 56 ? ? -146.45 23.46 73 16 ASN A 62 ? ? 63.10 90.64 74 17 TRP A 8 ? ? -172.71 142.05 75 17 ASP A 25 ? ? 46.92 79.56 76 17 PHE A 38 ? ? -151.93 85.22 77 17 GLN A 55 ? ? -69.99 95.24 78 17 ARG A 56 ? ? 76.77 -42.88 79 17 ASN A 62 ? ? 60.38 94.23 80 18 TRP A 8 ? ? 178.74 151.29 81 18 ASN A 10 ? ? -59.47 90.77 82 18 ASP A 25 ? ? -147.77 44.61 83 18 ASN A 62 ? ? 52.71 88.96 84 19 TRP A 8 ? ? -174.95 142.35 85 19 ASP A 24 ? ? -103.93 57.78 86 19 ASP A 36 ? ? 83.15 -72.50 87 19 ARG A 56 ? ? -148.58 16.86 88 19 ASN A 62 ? ? -23.96 126.57 89 20 ASP A 24 ? ? -105.62 56.15 90 20 ASP A 36 ? ? 70.65 -75.79 91 20 ARG A 56 ? ? -122.44 -56.41 92 20 ASN A 62 ? ? 59.04 99.68 #