data_2LZG # _entry.id 2LZG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LZG RCSB RCSB103019 BMRB 18755 WWPDB D_1000103019 # _pdbx_database_related.db_id 18755 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LZG _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-10-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Michelsen, K.B.' 1 'Jordan, J.B.' 2 'Lewis, J.' 3 'Long, A.M.' 4 'Yang, E.' 5 'Rew, Y.' 6 'Zhou, J.' 7 'Yakowec, P.' 8 'Schnier, P.D.' 9 'Huang, X.' 10 'Poppe, L.' 11 # _citation.id primary _citation.title 'Ordering of the N-Terminus of Human MDM2 by Small Molecule Inhibitors.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 134 _citation.page_first 17059 _citation.page_last 17067 _citation.year 2012 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22991965 _citation.pdbx_database_id_DOI 10.1021/ja305839b # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Michelsen, K.' 1 primary 'Jordan, J.B.' 2 primary 'Lewis, J.' 3 primary 'Long, A.M.' 4 primary 'Yang, E.' 5 primary 'Rew, Y.' 6 primary 'Zhou, J.' 7 primary 'Yakowec, P.' 8 primary 'Schnier, P.D.' 9 primary 'Huang, X.' 10 primary 'Poppe, L.' 11 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase Mdm2' 14159.176 1 ? ? ? ? 2 non-polymer syn '[(3R,5R,6S)-5-(3-chlorophenyl)-6-(4-chlorophenyl)-1-(cyclopropylmethyl)-2-oxopiperidin-3-yl]acetic acid' 432.340 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Double minute 2 protein, Hdm2, Oncoprotein Mdm2, p53-binding protein Mdm2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSND LLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN ; _entity_poly.pdbx_seq_one_letter_code_can ;MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSND LLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 CYS n 1 3 ASN n 1 4 THR n 1 5 ASN n 1 6 MET n 1 7 SER n 1 8 VAL n 1 9 PRO n 1 10 THR n 1 11 ASP n 1 12 GLY n 1 13 ALA n 1 14 VAL n 1 15 THR n 1 16 THR n 1 17 SER n 1 18 GLN n 1 19 ILE n 1 20 PRO n 1 21 ALA n 1 22 SER n 1 23 GLU n 1 24 GLN n 1 25 GLU n 1 26 THR n 1 27 LEU n 1 28 VAL n 1 29 ARG n 1 30 PRO n 1 31 LYS n 1 32 PRO n 1 33 LEU n 1 34 LEU n 1 35 LEU n 1 36 LYS n 1 37 LEU n 1 38 LEU n 1 39 LYS n 1 40 SER n 1 41 VAL n 1 42 GLY n 1 43 ALA n 1 44 GLN n 1 45 LYS n 1 46 ASP n 1 47 THR n 1 48 TYR n 1 49 THR n 1 50 MET n 1 51 LYS n 1 52 GLU n 1 53 VAL n 1 54 LEU n 1 55 PHE n 1 56 TYR n 1 57 LEU n 1 58 GLY n 1 59 GLN n 1 60 TYR n 1 61 ILE n 1 62 MET n 1 63 THR n 1 64 LYS n 1 65 ARG n 1 66 LEU n 1 67 TYR n 1 68 ASP n 1 69 GLU n 1 70 LYS n 1 71 GLN n 1 72 GLN n 1 73 HIS n 1 74 ILE n 1 75 VAL n 1 76 TYR n 1 77 CYS n 1 78 SER n 1 79 ASN n 1 80 ASP n 1 81 LEU n 1 82 LEU n 1 83 GLY n 1 84 ASP n 1 85 LEU n 1 86 PHE n 1 87 GLY n 1 88 VAL n 1 89 PRO n 1 90 SER n 1 91 PHE n 1 92 SER n 1 93 VAL n 1 94 LYS n 1 95 GLU n 1 96 HIS n 1 97 ARG n 1 98 LYS n 1 99 ILE n 1 100 TYR n 1 101 THR n 1 102 MET n 1 103 ILE n 1 104 TYR n 1 105 ARG n 1 106 ASN n 1 107 LEU n 1 108 VAL n 1 109 VAL n 1 110 VAL n 1 111 ASN n 1 112 GLN n 1 113 GLN n 1 114 GLU n 1 115 SER n 1 116 SER n 1 117 ASP n 1 118 SER n 1 119 GLY n 1 120 THR n 1 121 SER n 1 122 VAL n 1 123 SER n 1 124 GLU n 1 125 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MDM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MDM2_HUMAN _struct_ref.pdbx_db_accession Q00987 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSND LLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LZG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00987 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 13Q non-polymer . '[(3R,5R,6S)-5-(3-chlorophenyl)-6-(4-chlorophenyl)-1-(cyclopropylmethyl)-2-oxopiperidin-3-yl]acetic acid' ? 'C23 H23 Cl2 N O3' 432.340 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCA' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '500 uM [U-100% 13C; U-100% 15N] protein, 50 mM sodium chloride, 20 mM sodium phosphate, 5 mM [U-100% 2H] DTT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 500 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LZG _pdbx_nmr_refine.method 'torsion angle dynamics, DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LZG _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LZG _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement AMBER ? 3 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' 'structure solution' AMBER ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LZG _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LZG _struct.title 'NMR Structure of Mdm2 (6-125) with Pip-1' _struct.pdbx_descriptor 'E3 ubiquitin-protein ligase Mdm2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LZG _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Mdm2, oncogene protein-inhibitor complex, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 33 ? LYS A 36 ? LEU A 33 LYS A 36 5 ? 4 HELX_P HELX_P2 2 LEU A 37 ? GLY A 42 ? LEU A 37 GLY A 42 1 ? 6 HELX_P HELX_P3 3 MET A 50 ? LYS A 64 ? MET A 50 LYS A 64 1 ? 15 HELX_P HELX_P4 4 LEU A 81 ? PHE A 86 ? LEU A 81 PHE A 86 1 ? 6 HELX_P HELX_P5 5 GLU A 95 ? TYR A 104 ? GLU A 95 TYR A 104 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 27 ? VAL A 28 ? LEU A 27 VAL A 28 A 2 TYR A 48 ? THR A 49 ? TYR A 48 THR A 49 B 1 VAL A 75 ? TYR A 76 ? VAL A 75 TYR A 76 B 2 SER A 90 ? PHE A 91 ? SER A 90 PHE A 91 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 28 ? N VAL A 28 O TYR A 48 ? O TYR A 48 B 1 2 N VAL A 75 ? N VAL A 75 O PHE A 91 ? O PHE A 91 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE 13Q A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 VAL A 14 ? VAL A 14 . ? 1_555 ? 2 AC1 8 THR A 16 ? THR A 16 . ? 1_555 ? 3 AC1 8 LEU A 54 ? LEU A 54 . ? 1_555 ? 4 AC1 8 GLY A 58 ? GLY A 58 . ? 1_555 ? 5 AC1 8 ILE A 61 ? ILE A 61 . ? 1_555 ? 6 AC1 8 TYR A 67 ? TYR A 67 . ? 1_555 ? 7 AC1 8 LYS A 94 ? LYS A 94 . ? 1_555 ? 8 AC1 8 HIS A 96 ? HIS A 96 . ? 1_555 ? # _atom_sites.entry_id 2LZG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ASN 125 125 125 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 13Q _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 999 _pdbx_nonpoly_scheme.pdb_mon_id 13Q _pdbx_nonpoly_scheme.auth_mon_id 13Q _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-11-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 500 ? uM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-2' 50 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 DTT-4 5 ? mM '[U-100% 2H]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 4 ? ? -128.82 -59.78 2 1 MET A 6 ? ? -143.22 48.28 3 1 LYS A 31 ? ? -160.61 -55.79 4 1 PRO A 32 ? ? -59.35 -171.45 5 1 GLN A 44 ? ? -107.18 79.69 6 1 ARG A 65 ? ? 65.87 78.09 7 1 HIS A 73 ? ? -140.05 -47.35 8 1 SER A 118 ? ? -124.42 -61.07 9 2 ASN A 5 ? ? 63.49 87.64 10 2 MET A 6 ? ? -145.72 -63.46 11 2 THR A 10 ? ? -121.15 -56.10 12 2 LYS A 31 ? ? -168.68 -59.52 13 2 ARG A 65 ? ? 64.18 68.85 14 2 HIS A 73 ? ? -137.18 -42.65 15 2 SER A 78 ? ? -110.72 54.82 16 2 ASN A 106 ? ? -98.31 38.04 17 2 GLN A 113 ? ? -102.01 64.68 18 2 SER A 118 ? ? -96.11 -65.70 19 2 SER A 121 ? ? -108.30 45.54 20 2 VAL A 122 ? ? 60.09 103.38 21 2 SER A 123 ? ? -140.97 54.18 22 3 ASN A 5 ? ? -65.94 -82.34 23 3 LYS A 31 ? ? -131.18 -65.81 24 3 PRO A 32 ? ? -65.69 -172.39 25 3 ARG A 65 ? ? 63.29 77.21 26 3 GLU A 69 ? ? 72.87 143.94 27 3 GLN A 72 ? ? 51.86 137.04 28 3 HIS A 73 ? ? -139.30 -54.14 29 3 VAL A 110 ? ? -92.07 -62.69 30 3 GLN A 113 ? ? 70.24 130.08 31 3 ASP A 117 ? ? 69.83 143.25 32 4 ASP A 11 ? ? -123.32 -52.96 33 4 LYS A 31 ? ? -151.10 -63.57 34 4 ARG A 65 ? ? 62.91 87.49 35 4 TYR A 67 ? ? -102.26 48.02 36 4 GLN A 72 ? ? 48.70 109.72 37 4 HIS A 73 ? ? -140.93 -49.58 38 4 ASN A 106 ? ? -104.90 51.81 39 4 SER A 121 ? ? -115.39 51.29 40 4 VAL A 122 ? ? 61.67 95.03 41 5 LYS A 31 ? ? -160.15 -63.07 42 5 PRO A 32 ? ? -67.10 -168.73 43 5 ARG A 65 ? ? 63.51 76.30 44 5 GLN A 71 ? ? -118.99 -81.38 45 5 GLN A 72 ? ? 178.38 119.91 46 5 HIS A 73 ? ? -156.91 -58.64 47 5 ASN A 106 ? ? -94.64 38.83 48 5 GLU A 114 ? ? -163.64 103.80 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '[(3R,5R,6S)-5-(3-chlorophenyl)-6-(4-chlorophenyl)-1-(cyclopropylmethyl)-2-oxopiperidin-3-yl]acetic acid' _pdbx_entity_nonpoly.comp_id 13Q #