data_2M07 # _entry.id 2M07 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M07 RCSB RCSB103043 BMRB 18797 WWPDB D_1000103043 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4936 BMRB 'NMR resonance assignment of OmpX in DHPC micelles' unspecified 1q9f PDB 'NMR structure of OmpX in DHPC micelles' unspecified 1qj8 PDB 'Crystal structure of OmpX' unspecified 18796 BMRB 'NMR resonance assignment of OmpX in phospholipid nanodiscs' unspecified 2m06 PDB 'NMR structure of OmpX in phospholipid nanodiscs' unspecified 18797 BMRB . unspecified MPSbyNMR-013 TargetTrack . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M07 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-10-21 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hagn, F.X.' 1 'Etzkorn, M.' 2 'Raschle, T.' 3 'Wagner, G.' 4 'Membrane Protein Structures by Solution NMR (MPSbyNMR)' 5 # _citation.id primary _citation.title 'Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 135 _citation.page_first 1919 _citation.page_last 1925 _citation.year 2013 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23294159 _citation.pdbx_database_id_DOI 10.1021/ja310901f # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hagn, F.' 1 primary 'Etzkorn, M.' 2 primary 'Raschle, T.' 3 primary 'Wagner, G.' 4 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Outer membrane protein X' _entity.formula_weight 16395.812 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 24-171' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIY GVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIY GVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MPSbyNMR-013 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 VAL n 1 6 THR n 1 7 GLY n 1 8 GLY n 1 9 TYR n 1 10 ALA n 1 11 GLN n 1 12 SER n 1 13 ASP n 1 14 ALA n 1 15 GLN n 1 16 GLY n 1 17 GLN n 1 18 MET n 1 19 ASN n 1 20 LYS n 1 21 MET n 1 22 GLY n 1 23 GLY n 1 24 PHE n 1 25 ASN n 1 26 LEU n 1 27 LYS n 1 28 TYR n 1 29 ARG n 1 30 TYR n 1 31 GLU n 1 32 GLU n 1 33 ASP n 1 34 ASN n 1 35 SER n 1 36 PRO n 1 37 LEU n 1 38 GLY n 1 39 VAL n 1 40 ILE n 1 41 GLY n 1 42 SER n 1 43 PHE n 1 44 THR n 1 45 TYR n 1 46 THR n 1 47 GLU n 1 48 LYS n 1 49 SER n 1 50 ARG n 1 51 THR n 1 52 ALA n 1 53 SER n 1 54 SER n 1 55 GLY n 1 56 ASP n 1 57 TYR n 1 58 ASN n 1 59 LYS n 1 60 ASN n 1 61 GLN n 1 62 TYR n 1 63 TYR n 1 64 GLY n 1 65 ILE n 1 66 THR n 1 67 ALA n 1 68 GLY n 1 69 PRO n 1 70 ALA n 1 71 TYR n 1 72 ARG n 1 73 ILE n 1 74 ASN n 1 75 ASP n 1 76 TRP n 1 77 ALA n 1 78 SER n 1 79 ILE n 1 80 TYR n 1 81 GLY n 1 82 VAL n 1 83 VAL n 1 84 GLY n 1 85 VAL n 1 86 GLY n 1 87 TYR n 1 88 GLY n 1 89 LYS n 1 90 PHE n 1 91 GLN n 1 92 THR n 1 93 THR n 1 94 GLU n 1 95 TYR n 1 96 PRO n 1 97 THR n 1 98 TYR n 1 99 LYS n 1 100 HIS n 1 101 ASP n 1 102 THR n 1 103 SER n 1 104 ASP n 1 105 TYR n 1 106 GLY n 1 107 PHE n 1 108 SER n 1 109 TYR n 1 110 GLY n 1 111 ALA n 1 112 GLY n 1 113 LEU n 1 114 GLN n 1 115 PHE n 1 116 ASN n 1 117 PRO n 1 118 MET n 1 119 GLU n 1 120 ASN n 1 121 VAL n 1 122 ALA n 1 123 LEU n 1 124 ASP n 1 125 PHE n 1 126 SER n 1 127 TYR n 1 128 GLU n 1 129 GLN n 1 130 SER n 1 131 ARG n 1 132 ILE n 1 133 ARG n 1 134 SER n 1 135 VAL n 1 136 ASP n 1 137 VAL n 1 138 GLY n 1 139 THR n 1 140 TRP n 1 141 ILE n 1 142 ALA n 1 143 GLY n 1 144 VAL n 1 145 GLY n 1 146 TYR n 1 147 ARG n 1 148 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ompX, ybiG, b0814, JW0799' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET11a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OMPX_ECOLI _struct_ref.pdbx_db_accession P0A917 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIY GVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M07 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A917 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D HNCACB' 1 7 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '20 mM potassium phosphate, 50 mM sodium chloride, 10 mM EDTA, 0.05 % sodium azide, 110 mM DPC, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Bruker Avance 1 'Bruker Avance' 800 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M07 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M07 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M07 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Bruker Biospin' collection TOPSPIN ? 2 'Bruker Biospin' processing TOPSPIN ? 3 Goddard 'data analysis' SPARKY ? 4 Goddard 'chemical shift assignment' SPARKY ? 5 Goddard 'peak picking' SPARKY ? 6 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M07 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M07 _struct.title 'NMR structure of OmpX in DPC micelles' _struct.pdbx_descriptor 'Outer membrane protein X' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M07 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'beta barrel, MEMBRANE PROTEIN, Structural Genomics, PSI-Biology, Membrane Protein Structures by Solution NMR, MPSbyNMR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id MET _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 118 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 121 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id MET _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 118 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 121 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 4 ? SER A 12 ? THR A 4 SER A 12 A 2 MET A 21 ? ARG A 29 ? MET A 21 ARG A 29 A 3 GLY A 38 ? GLU A 47 ? GLY A 38 GLU A 47 A 4 ASN A 60 ? TYR A 71 ? ASN A 60 TYR A 71 A 5 SER A 78 ? PHE A 90 ? SER A 78 PHE A 90 A 6 SER A 103 ? PHE A 115 ? SER A 103 PHE A 115 A 7 ALA A 122 ? SER A 130 ? ALA A 122 SER A 130 A 8 VAL A 137 ? ARG A 147 ? VAL A 137 ARG A 147 A 9 THR A 4 ? SER A 12 ? THR A 4 SER A 12 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 10 ? N ALA A 10 O GLY A 23 ? O GLY A 23 A 2 3 N GLY A 22 ? N GLY A 22 O GLU A 47 ? O GLU A 47 A 3 4 N GLY A 38 ? N GLY A 38 O ALA A 70 ? O ALA A 70 A 4 5 N TYR A 71 ? N TYR A 71 O ILE A 79 ? O ILE A 79 A 5 6 N GLY A 86 ? N GLY A 86 O GLY A 106 ? O GLY A 106 A 6 7 N TYR A 109 ? N TYR A 109 O GLN A 129 ? O GLN A 129 A 7 8 N SER A 126 ? N SER A 126 O ILE A 141 ? O ILE A 141 A 8 9 O VAL A 144 ? O VAL A 144 N GLY A 7 ? N GLY A 7 # _atom_sites.entry_id 2M07 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 PHE 148 148 148 PHE PHE A . n # _pdbx_SG_project.full_name_of_center 'Membrane Protein Structures by Solution NMR' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center MPSbyNMR _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-12-12 2 'Structure model' 1 1 2013-01-23 3 'Structure model' 1 2 2013-02-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 50 ? mM ? 1 EDTA-3 10 ? mM ? 1 'sodium azide-4' 0.05 ? % ? 1 DPC-5 110 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 53 ? ? 62.98 132.12 2 1 ASN A 58 ? ? 35.12 31.49 3 1 TRP A 76 ? ? -86.16 46.28 4 1 GLU A 94 ? ? -175.78 -69.48 5 1 PRO A 96 ? ? -45.77 99.79 6 1 GLU A 119 ? ? 66.48 -171.94 7 2 GLN A 17 ? ? 69.86 -0.58 8 2 SER A 49 ? ? 62.36 -81.75 9 2 ALA A 52 ? ? -67.88 93.96 10 2 LYS A 59 ? ? -138.35 -68.01 11 2 TRP A 76 ? ? -86.06 47.94 12 2 THR A 93 ? ? -162.77 -66.26 13 2 THR A 102 ? ? 47.14 -169.68 14 2 GLU A 119 ? ? 67.27 -165.95 15 3 GLN A 17 ? ? 155.58 -44.45 16 3 LYS A 20 ? ? -58.15 170.66 17 3 ASP A 56 ? ? 61.93 -174.40 18 3 TYR A 57 ? ? -54.54 -175.69 19 3 ASP A 75 ? ? -86.44 38.46 20 3 GLU A 119 ? ? 67.24 -167.61 21 4 THR A 2 ? ? -148.85 -58.34 22 4 ASP A 56 ? ? 66.66 -79.56 23 4 ASP A 75 ? ? -165.31 85.57 24 4 HIS A 100 ? ? -49.74 97.27 25 4 GLU A 119 ? ? 67.84 -166.48 26 5 GLN A 17 ? ? 170.50 -52.91 27 5 LYS A 20 ? ? -49.50 163.78 28 5 ARG A 50 ? ? -98.44 -68.90 29 5 ASP A 56 ? ? 62.23 152.30 30 5 ASN A 58 ? ? -173.58 111.85 31 5 LYS A 59 ? ? -147.43 -74.55 32 5 TRP A 76 ? ? 40.39 29.51 33 5 MET A 118 ? ? -55.71 174.03 34 5 GLU A 119 ? ? 65.35 -174.70 35 6 SER A 49 ? ? -166.22 34.73 36 6 ASN A 60 ? ? 61.79 109.48 37 6 TRP A 76 ? ? -87.47 40.77 38 6 GLU A 94 ? ? 54.79 88.13 39 6 GLU A 119 ? ? 78.35 -167.48 40 7 GLN A 17 ? ? 165.08 -54.55 41 7 ARG A 50 ? ? -167.30 -68.25 42 7 ASN A 60 ? ? 66.91 140.12 43 7 ASP A 75 ? ? -78.98 -168.61 44 7 TRP A 76 ? ? -85.49 45.05 45 7 GLU A 94 ? ? -104.35 -71.62 46 7 TYR A 98 ? ? -174.10 -54.97 47 7 THR A 102 ? ? 67.18 169.94 48 7 GLU A 119 ? ? 74.26 -157.12 49 8 ASP A 75 ? ? -173.75 96.49 50 8 GLU A 94 ? ? 45.71 23.26 51 8 TYR A 98 ? ? 51.30 -91.65 52 8 GLU A 119 ? ? 65.45 -173.79 53 9 GLN A 17 ? ? 169.58 -54.49 54 9 ASP A 56 ? ? 80.53 -40.18 55 9 TRP A 76 ? ? 45.64 25.55 56 9 TYR A 95 ? ? -176.34 149.42 57 9 PRO A 96 ? ? -91.52 53.93 58 9 MET A 118 ? ? -53.99 177.51 59 9 GLU A 119 ? ? 63.73 -175.06 60 10 LYS A 20 ? ? -56.42 172.44 61 10 ASP A 56 ? ? 75.35 -75.18 62 10 ASP A 75 ? ? -69.68 -178.20 63 10 TRP A 76 ? ? -87.40 40.84 64 10 HIS A 100 ? ? 61.20 71.04 65 10 MET A 118 ? ? -59.33 170.17 66 10 GLU A 119 ? ? 65.39 -171.35 67 11 TYR A 57 ? ? 63.92 139.29 68 11 TRP A 76 ? ? -86.82 48.24 69 11 HIS A 100 ? ? 63.69 144.68 70 11 MET A 118 ? ? -58.69 176.56 71 11 GLU A 119 ? ? 61.64 -174.45 72 12 THR A 2 ? ? -124.85 -62.16 73 12 LYS A 59 ? ? -95.08 -68.48 74 12 ASP A 75 ? ? -65.71 -179.25 75 12 TRP A 76 ? ? -88.05 37.47 76 12 GLU A 119 ? ? 65.39 -174.47 77 13 ASN A 58 ? ? 55.22 89.05 78 13 ASN A 74 ? ? -94.82 -66.52 79 13 GLU A 119 ? ? 65.35 -175.91 80 14 GLN A 17 ? ? 83.49 -28.09 81 14 ASP A 56 ? ? 64.52 144.23 82 14 GLU A 119 ? ? 71.81 -153.73 83 15 ASP A 56 ? ? 60.96 62.54 84 15 ASN A 58 ? ? -159.13 -73.84 85 15 ASN A 60 ? ? -175.16 120.87 86 15 ASP A 75 ? ? -69.50 -178.47 87 15 TRP A 76 ? ? -86.09 48.70 88 15 HIS A 100 ? ? 80.75 -42.70 89 15 GLU A 119 ? ? 79.31 -164.16 90 16 ARG A 50 ? ? 47.99 93.69 91 16 ALA A 52 ? ? -60.53 93.78 92 16 SER A 53 ? ? -178.34 -175.34 93 16 ASN A 58 ? ? -55.67 170.16 94 16 LYS A 59 ? ? -134.65 -155.18 95 16 TRP A 76 ? ? -85.72 49.79 96 16 GLU A 119 ? ? 68.15 -148.31 97 17 TRP A 76 ? ? -86.77 48.55 98 17 GLU A 94 ? ? 63.94 -83.43 99 17 TYR A 98 ? ? 46.44 92.82 100 17 HIS A 100 ? ? -173.27 43.22 101 17 GLU A 119 ? ? 72.98 -160.48 102 18 THR A 2 ? ? -159.14 -50.49 103 18 ALA A 52 ? ? -58.08 95.24 104 18 ASN A 58 ? ? 59.28 83.10 105 18 TRP A 76 ? ? -126.45 -169.67 106 18 GLU A 94 ? ? 49.66 26.46 107 18 GLU A 119 ? ? 79.28 -162.60 108 19 GLN A 17 ? ? 167.65 -52.41 109 19 ASP A 56 ? ? 56.68 101.17 110 19 TYR A 57 ? ? -55.93 -74.88 111 19 TRP A 76 ? ? -85.61 48.05 112 19 GLU A 94 ? ? -64.53 86.55 113 19 PRO A 96 ? ? -47.90 172.32 114 19 THR A 102 ? ? 53.34 -173.92 115 19 GLU A 119 ? ? 71.46 -145.25 116 20 LYS A 48 ? ? -172.31 136.67 117 20 SER A 49 ? ? -177.92 -176.80 118 20 THR A 51 ? ? -47.19 96.85 119 20 SER A 53 ? ? -59.00 171.76 120 20 TYR A 57 ? ? 59.12 -94.80 121 20 ASN A 60 ? ? 60.43 103.16 122 20 TYR A 95 ? ? 177.27 -55.11 123 20 TYR A 98 ? ? -175.01 -67.47 124 20 HIS A 100 ? ? 64.07 -84.10 125 20 GLU A 119 ? ? 68.58 -165.31 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG A 131 ? ? ILE A 132 ? ? -146.65 2 2 ARG A 131 ? ? ILE A 132 ? ? -144.19 3 3 ARG A 131 ? ? ILE A 132 ? ? -141.23 4 4 ARG A 131 ? ? ILE A 132 ? ? -142.87 5 5 ARG A 131 ? ? ILE A 132 ? ? -143.34 6 6 ARG A 131 ? ? ILE A 132 ? ? -144.30 7 7 ARG A 131 ? ? ILE A 132 ? ? -146.94 8 8 ARG A 131 ? ? ILE A 132 ? ? -144.02 9 9 ARG A 131 ? ? ILE A 132 ? ? -144.94 10 10 ARG A 131 ? ? ILE A 132 ? ? -146.38 11 11 ARG A 131 ? ? ILE A 132 ? ? -145.30 12 12 ARG A 131 ? ? ILE A 132 ? ? -147.80 13 13 ARG A 131 ? ? ILE A 132 ? ? -145.21 14 14 ARG A 131 ? ? ILE A 132 ? ? -143.38 15 15 ARG A 131 ? ? ILE A 132 ? ? -146.56 16 16 ARG A 131 ? ? ILE A 132 ? ? -142.09 17 17 ARG A 131 ? ? ILE A 132 ? ? -144.79 18 18 ARG A 131 ? ? ILE A 132 ? ? -144.48 19 19 ARG A 131 ? ? ILE A 132 ? ? -142.74 20 20 ARG A 131 ? ? ILE A 132 ? ? -145.53 #