data_2M08 # _entry.id 2M08 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M08 pdb_00002m08 10.2210/pdb2m08/pdb RCSB RCSB103044 ? ? BMRB 18801 ? 10.13018/BMR18801 WWPDB D_1000103044 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-23 2 'Structure model' 1 1 2016-07-06 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M08 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-10-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18801 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lederer, C.' 1 'Bayer, P.' 2 # _citation.id primary _citation.title 'NmPin from the marine thaumarchaeote Nitrosopumilus maritimus is an active membrane associated prolyl isomerase.' _citation.journal_abbrev 'Bmc Biol.' _citation.journal_volume 14 _citation.page_first 53 _citation.page_last 53 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1741-7007 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27349962 _citation.pdbx_database_id_DOI 10.1186/s12915-016-0274-1 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoppstock, L.' 1 ? primary 'Trusch, F.' 2 ? primary 'Lederer, C.' 3 ? primary 'van West, P.' 4 ? primary 'Koenneke, M.' 5 ? primary 'Bayer, P.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PpiC-type peptidyl-prolyl cis-trans isomerase' _entity.formula_weight 10197.915 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPI KSEFGYHIIKRFG ; _entity_poly.pdbx_seq_one_letter_code_can ;GPSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPI KSEFGYHIIKRFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 SER n 1 4 ASN n 1 5 LYS n 1 6 ILE n 1 7 LYS n 1 8 CYS n 1 9 SER n 1 10 HIS n 1 11 ILE n 1 12 LEU n 1 13 VAL n 1 14 SER n 1 15 LYS n 1 16 GLN n 1 17 SER n 1 18 GLU n 1 19 ALA n 1 20 LEU n 1 21 ALA n 1 22 ILE n 1 23 MET n 1 24 GLU n 1 25 LYS n 1 26 LEU n 1 27 LYS n 1 28 SER n 1 29 GLY n 1 30 GLU n 1 31 LYS n 1 32 PHE n 1 33 GLY n 1 34 LYS n 1 35 LEU n 1 36 ALA n 1 37 LYS n 1 38 GLU n 1 39 LEU n 1 40 SER n 1 41 ILE n 1 42 ASP n 1 43 SER n 1 44 GLY n 1 45 SER n 1 46 ALA n 1 47 LYS n 1 48 LYS n 1 49 ASN n 1 50 GLY n 1 51 ASN n 1 52 LEU n 1 53 GLY n 1 54 TYR n 1 55 PHE n 1 56 THR n 1 57 LYS n 1 58 GLY n 1 59 MET n 1 60 MET n 1 61 VAL n 1 62 LYS n 1 63 PRO n 1 64 PHE n 1 65 GLU n 1 66 ASP n 1 67 ALA n 1 68 ALA n 1 69 PHE n 1 70 LYS n 1 71 LEU n 1 72 GLN n 1 73 VAL n 1 74 GLY n 1 75 GLU n 1 76 VAL n 1 77 SER n 1 78 GLU n 1 79 PRO n 1 80 ILE n 1 81 LYS n 1 82 SER n 1 83 GLU n 1 84 PHE n 1 85 GLY n 1 86 TYR n 1 87 HIS n 1 88 ILE n 1 89 ILE n 1 90 LYS n 1 91 ARG n 1 92 PHE n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nmar0942, Nmar_0942' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain SCM1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitrosopumilus maritimus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 436308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET41 (a-c)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M08 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M08 _struct.title 'The solution structure of NmPin, the parvuline of Nitrosopumilus maritimus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M08 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'parvulin, archaeal, membrane, Thaumarchaeota, sdPar, ISOMERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A9A2C7_NITMS _struct_ref.pdbx_db_accession A9A2C7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKS EFGYHIIKRFG ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M08 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A9A2C7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M08 GLY A 1 ? UNP A9A2C7 ? ? 'expression tag' 1 1 1 2M08 PRO A 2 ? UNP A9A2C7 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 15 ? LEU A 20 ? LYS A 15 LEU A 20 1 ? 6 HELX_P HELX_P2 2 LEU A 20 ? LEU A 26 ? LEU A 20 LEU A 26 1 ? 7 HELX_P HELX_P3 3 LYS A 27 ? GLY A 29 ? LYS A 27 GLY A 29 5 ? 3 HELX_P HELX_P4 4 LYS A 31 ? LYS A 37 ? LYS A 31 LYS A 37 1 ? 7 HELX_P HELX_P5 5 VAL A 61 ? ASP A 66 ? VAL A 61 ASP A 66 1 ? 6 HELX_P HELX_P6 6 ALA A 67 ? PHE A 69 ? ALA A 67 PHE A 69 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 6 ? SER A 9 ? ILE A 6 SER A 9 A 2 ASN A 51 ? PHE A 55 ? ASN A 51 PHE A 55 B 1 LEU A 12 ? VAL A 13 ? LEU A 12 VAL A 13 B 2 TYR A 86 ? HIS A 87 ? TYR A 86 HIS A 87 B 3 ILE A 80 ? LYS A 81 ? ILE A 80 LYS A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 8 ? N CYS A 8 O GLY A 53 ? O GLY A 53 B 1 2 N VAL A 13 ? N VAL A 13 O TYR A 86 ? O TYR A 86 B 2 3 O HIS A 87 ? O HIS A 87 N ILE A 80 ? N ILE A 80 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 9 ? ? -121.69 -167.47 2 1 HIS A 10 ? ? -172.56 142.97 3 1 GLU A 38 ? ? -142.55 -64.56 4 1 SER A 40 ? ? -51.68 103.30 5 1 SER A 45 ? ? -157.53 -41.09 6 1 PRO A 63 ? ? -69.71 46.56 7 1 PHE A 64 ? ? -165.98 -60.35 8 1 ALA A 67 ? ? -94.80 31.44 9 1 VAL A 73 ? ? -63.05 95.18 10 1 PRO A 79 ? ? -69.69 85.16 11 2 PRO A 2 ? ? -69.73 -178.96 12 2 SER A 9 ? ? -121.25 -167.75 13 2 GLU A 24 ? ? -121.78 -55.53 14 2 GLU A 38 ? ? -139.67 -62.28 15 2 SER A 40 ? ? -52.01 103.33 16 2 SER A 45 ? ? -160.10 -44.93 17 2 PRO A 63 ? ? -69.79 46.56 18 2 PHE A 64 ? ? -167.03 -60.31 19 2 VAL A 73 ? ? -62.62 98.30 20 2 PRO A 79 ? ? -69.73 83.14 21 2 PHE A 92 ? ? -131.49 -35.00 22 3 SER A 9 ? ? -119.97 -168.48 23 3 HIS A 10 ? ? -171.15 147.16 24 3 GLU A 38 ? ? -139.39 -58.03 25 3 SER A 40 ? ? -51.61 103.33 26 3 ASP A 42 ? ? -59.50 109.03 27 3 SER A 45 ? ? -160.68 -42.31 28 3 PRO A 63 ? ? -69.84 46.31 29 3 PHE A 64 ? ? -165.72 -62.17 30 3 ALA A 67 ? ? -94.97 32.41 31 3 VAL A 73 ? ? -58.32 102.38 32 3 PRO A 79 ? ? -69.76 83.70 33 4 ASN A 4 ? ? -95.17 -62.25 34 4 SER A 9 ? ? -120.52 -168.96 35 4 HIS A 10 ? ? -170.29 147.06 36 4 GLU A 30 ? ? -76.76 -168.08 37 4 GLU A 38 ? ? -136.50 -60.81 38 4 SER A 40 ? ? -51.75 104.25 39 4 SER A 45 ? ? -160.02 -41.24 40 4 PRO A 63 ? ? -69.77 45.80 41 4 PHE A 64 ? ? -165.83 -62.46 42 4 ALA A 67 ? ? -93.58 32.51 43 4 VAL A 73 ? ? -65.67 90.26 44 4 PRO A 79 ? ? -69.74 83.22 45 5 SER A 9 ? ? -118.39 -167.81 46 5 HIS A 10 ? ? -171.73 144.72 47 5 GLU A 30 ? ? -104.65 -167.94 48 5 GLU A 38 ? ? -135.58 -58.85 49 5 SER A 40 ? ? -51.37 103.63 50 5 SER A 45 ? ? -158.31 -40.99 51 5 PRO A 63 ? ? -69.70 46.57 52 5 PHE A 64 ? ? -165.78 -60.83 53 5 VAL A 73 ? ? -62.36 92.34 54 5 SER A 77 ? ? -69.75 -166.74 55 5 PRO A 79 ? ? -69.73 85.78 56 6 PRO A 2 ? ? -69.71 -174.68 57 6 SER A 3 ? ? -106.63 46.46 58 6 GLU A 38 ? ? -140.50 -58.41 59 6 SER A 40 ? ? -51.52 103.34 60 6 SER A 45 ? ? -161.32 -44.29 61 6 PRO A 63 ? ? -69.78 46.66 62 6 PHE A 64 ? ? -166.21 -61.38 63 6 PRO A 79 ? ? -69.71 83.60 64 7 SER A 9 ? ? -120.37 -167.31 65 7 GLU A 38 ? ? -135.55 -57.16 66 7 SER A 40 ? ? -50.65 104.11 67 7 SER A 45 ? ? -158.69 -46.04 68 7 PRO A 63 ? ? -69.75 46.93 69 7 PHE A 64 ? ? -166.68 -61.10 70 7 SER A 77 ? ? -72.20 -166.36 71 7 PRO A 79 ? ? -69.73 85.35 72 8 ASN A 4 ? ? -142.36 -41.95 73 8 SER A 9 ? ? -116.44 -167.43 74 8 HIS A 10 ? ? -170.47 146.82 75 8 GLU A 38 ? ? -131.00 -54.82 76 8 SER A 40 ? ? -51.37 103.82 77 8 SER A 45 ? ? -163.45 -44.26 78 8 PRO A 63 ? ? -69.69 46.25 79 8 PHE A 64 ? ? -166.92 -58.91 80 8 ALA A 67 ? ? -95.84 33.75 81 8 VAL A 73 ? ? -64.18 92.41 82 8 PRO A 79 ? ? -69.72 90.77 83 9 SER A 9 ? ? -121.02 -168.20 84 9 HIS A 10 ? ? -170.52 143.13 85 9 GLU A 38 ? ? -132.25 -52.44 86 9 SER A 40 ? ? -52.99 102.89 87 9 SER A 45 ? ? -159.45 -40.74 88 9 PRO A 63 ? ? -69.83 46.46 89 9 PHE A 64 ? ? -166.64 -61.47 90 9 ALA A 67 ? ? -94.66 30.65 91 9 VAL A 73 ? ? -50.63 103.73 92 9 PRO A 79 ? ? -69.71 85.04 93 10 SER A 9 ? ? -117.81 -167.23 94 10 HIS A 10 ? ? -172.38 146.06 95 10 GLU A 30 ? ? -58.33 -75.73 96 10 LYS A 31 ? ? -179.38 100.69 97 10 GLU A 38 ? ? -137.90 -60.39 98 10 SER A 40 ? ? -51.32 104.71 99 10 SER A 45 ? ? -158.91 -41.73 100 10 PRO A 63 ? ? -69.77 47.21 101 10 PHE A 64 ? ? -167.18 -61.44 102 10 VAL A 73 ? ? -63.21 93.21 103 10 PRO A 79 ? ? -69.72 85.64 104 11 GLU A 30 ? ? -61.88 -75.89 105 11 LYS A 31 ? ? -179.81 102.92 106 11 GLU A 38 ? ? -139.77 -61.17 107 11 SER A 40 ? ? -50.57 104.00 108 11 SER A 45 ? ? -158.37 -45.41 109 11 PRO A 63 ? ? -69.74 46.89 110 11 PHE A 64 ? ? -167.05 -61.18 111 11 VAL A 73 ? ? -60.81 98.68 112 11 SER A 77 ? ? -77.05 -166.66 113 11 PRO A 79 ? ? -69.69 84.25 114 12 PRO A 2 ? ? -69.83 91.42 115 12 SER A 9 ? ? -120.99 -168.23 116 12 HIS A 10 ? ? -170.44 145.00 117 12 GLU A 30 ? ? -100.74 -167.82 118 12 GLU A 38 ? ? -136.09 -59.67 119 12 SER A 40 ? ? -50.88 104.13 120 12 SER A 45 ? ? -157.56 -41.91 121 12 PRO A 63 ? ? -69.73 46.01 122 12 PHE A 64 ? ? -167.06 -59.53 123 12 ALA A 67 ? ? -104.26 40.73 124 12 VAL A 73 ? ? -65.44 91.80 125 12 SER A 77 ? ? -79.38 -167.00 126 12 PRO A 79 ? ? -69.82 84.16 127 13 SER A 9 ? ? -118.05 -169.75 128 13 GLU A 30 ? ? -112.99 -167.91 129 13 GLU A 38 ? ? -138.10 -62.68 130 13 SER A 40 ? ? -51.11 104.67 131 13 SER A 45 ? ? -159.05 -42.26 132 13 PRO A 63 ? ? -69.77 45.86 133 13 PHE A 64 ? ? -166.46 -59.26 134 13 VAL A 73 ? ? -62.73 99.95 135 13 SER A 77 ? ? -79.58 -166.62 136 13 PRO A 79 ? ? -69.77 84.50 137 14 SER A 9 ? ? -116.50 -168.28 138 14 GLU A 38 ? ? -139.48 -62.51 139 14 SER A 40 ? ? -51.62 106.59 140 14 SER A 45 ? ? -153.78 -43.94 141 14 PRO A 63 ? ? -69.78 46.95 142 14 PHE A 64 ? ? -167.93 -59.21 143 14 ALA A 67 ? ? -94.80 33.66 144 14 SER A 77 ? ? -77.92 -167.63 145 14 PRO A 79 ? ? -69.88 83.82 146 15 SER A 9 ? ? -118.74 -167.57 147 15 HIS A 10 ? ? -172.29 146.59 148 15 GLU A 30 ? ? -75.67 -166.99 149 15 GLU A 38 ? ? -142.48 -58.87 150 15 SER A 40 ? ? -53.27 102.26 151 15 PRO A 63 ? ? -69.79 46.14 152 15 PHE A 64 ? ? -167.47 -58.07 153 15 ALA A 67 ? ? -99.61 36.80 154 15 VAL A 73 ? ? -58.79 97.62 155 15 SER A 77 ? ? -78.79 -168.32 156 15 PRO A 79 ? ? -69.80 85.91 157 16 SER A 9 ? ? -118.65 -167.92 158 16 GLU A 24 ? ? -124.90 -51.05 159 16 GLU A 38 ? ? -137.81 -61.19 160 16 SER A 40 ? ? -50.36 104.15 161 16 SER A 45 ? ? -159.66 -41.81 162 16 PRO A 63 ? ? -69.73 47.26 163 16 PHE A 64 ? ? -167.51 -59.88 164 16 ALA A 67 ? ? -97.57 35.13 165 16 PRO A 79 ? ? -69.70 85.91 166 17 SER A 9 ? ? -116.77 -167.51 167 17 HIS A 10 ? ? -170.80 146.13 168 17 GLU A 38 ? ? -146.12 -62.45 169 17 SER A 40 ? ? -52.09 102.39 170 17 PRO A 63 ? ? -69.82 47.02 171 17 PHE A 64 ? ? -168.49 -57.76 172 17 ALA A 67 ? ? -95.28 33.89 173 17 VAL A 73 ? ? -57.56 98.25 174 17 SER A 77 ? ? -76.59 -167.25 175 17 PRO A 79 ? ? -69.77 85.26 176 18 HIS A 10 ? ? -171.19 148.30 177 18 GLU A 38 ? ? -136.84 -59.93 178 18 SER A 40 ? ? -51.01 104.16 179 18 SER A 45 ? ? -155.53 -41.57 180 18 PRO A 63 ? ? -69.77 46.31 181 18 PHE A 64 ? ? -166.26 -61.32 182 18 VAL A 73 ? ? -57.48 98.04 183 18 SER A 77 ? ? -77.25 -166.47 184 18 PRO A 79 ? ? -69.72 83.27 185 19 PRO A 2 ? ? -69.73 93.82 186 19 SER A 9 ? ? -118.47 -167.54 187 19 HIS A 10 ? ? -170.10 145.56 188 19 GLU A 30 ? ? -55.14 -76.26 189 19 LYS A 31 ? ? 179.88 99.92 190 19 GLU A 38 ? ? -136.66 -60.88 191 19 SER A 40 ? ? -50.80 109.17 192 19 SER A 45 ? ? -159.58 -44.69 193 19 PRO A 63 ? ? -69.67 46.69 194 19 PHE A 64 ? ? -166.13 -60.43 195 19 VAL A 73 ? ? -66.04 88.06 196 19 PRO A 79 ? ? -69.85 85.17 197 20 HIS A 10 ? ? -173.24 147.62 198 20 GLU A 30 ? ? -72.93 -166.18 199 20 GLU A 38 ? ? -135.86 -55.73 200 20 SER A 40 ? ? -50.23 105.44 201 20 SER A 45 ? ? -156.82 -44.15 202 20 PRO A 63 ? ? -69.71 46.77 203 20 PHE A 64 ? ? -166.92 -59.77 204 20 SER A 77 ? ? -70.64 -167.01 205 20 PRO A 79 ? ? -69.78 85.19 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M08 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 1.079 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2M08 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M08 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-99% 13C; U-99% 15N] protein, 50 mM [U-99% 13C; U-99% 15N] potassium phosphate, 2 uM [U-99% 13C; U-99% 15N] DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' '1 mM [U-99% 13C; U-99% 15N] protein, 50 mM [U-99% 13C; U-99% 15N] potassium phosphate, 2 uM [U-99% 13C; U-99% 15N] DSS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate-2' 50 ? mM '[U-99% 13C; U-99% 15N]' 1 DSS-3 2 ? uM '[U-99% 13C; U-99% 15N]' 1 entity-4 1 ? mM '[U-99% 13C; U-99% 15N]' 2 'potassium phosphate-5' 50 ? mM '[U-99% 13C; U-99% 15N]' 2 DSS-6 2 ? uM '[U-99% 13C; U-99% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 301.5 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H TOCSY' 1 4 1 '2D 1H-1H COSY' 1 5 1 '2D 1H-1H NOESY' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D HCCH-COSY' 1 10 2 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M08 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1846 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 252 _pdbx_nmr_constraints.NOE_long_range_total_count 740 _pdbx_nmr_constraints.NOE_medium_range_total_count 1106 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 436 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2M08 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 3.0 1 'Bruker Biospin' processing TopSpin 3.0 2 CCPN 'chemical shift assignment' CCPN 2.1 3 CCPN 'chemical shift calculation' CCPN 2.1 4 CCPN 'peak picking' CCPN 2.1 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 7 'Guntert, Mumenthaler and Wuthrich' 'data analysis' CYANA 3.0 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Ultrashield _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Ultrashield' # _atom_sites.entry_id 2M08 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #