data_2M0Q # _entry.id 2M0Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M0Q pdb_00002m0q 10.2210/pdb2m0q/pdb RCSB RCSB103062 ? ? BMRB 18817 ? ? WWPDB D_1000103062 ? ? # _pdbx_database_related.db_id 18817 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M0Q _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-11-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lai, C.' 1 'Li, P.' 2 'Chen, L.' 3 'Zhang, L.' 4 'Wu, F.' 5 'Tian, C.' 6 # _citation.id primary _citation.title 'Differential modulations of KCNQ1 by auxiliary proteins KCNE1 and KCNE2.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 4 _citation.page_first 4973 _citation.page_last 4973 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24827085 _citation.pdbx_database_id_DOI 10.1038/srep04973 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, P.' 1 ? primary 'Liu, H.' 2 ? primary 'Lai, C.' 3 ? primary 'Sun, P.' 4 ? primary 'Zeng, W.' 5 ? primary 'Wu, F.' 6 ? primary 'Zhang, L.' 7 ? primary 'Wang, S.' 8 ? primary 'Tian, C.' 9 ? primary 'Ding, J.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Potassium voltage-gated channel subfamily E member 2' _entity.formula_weight 14486.493 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MinK-related peptide 1, Minimum potassium ion channel-related peptide 1, Potassium channel subunit beta MiRP1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHS NDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP ; _entity_poly.pdbx_seq_one_letter_code_can ;MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHS NDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 THR n 1 4 LEU n 1 5 SER n 1 6 ASN n 1 7 PHE n 1 8 THR n 1 9 GLN n 1 10 THR n 1 11 LEU n 1 12 GLU n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 ARG n 1 17 ARG n 1 18 ILE n 1 19 PHE n 1 20 ILE n 1 21 THR n 1 22 TYR n 1 23 MET n 1 24 ASP n 1 25 ASN n 1 26 TRP n 1 27 ARG n 1 28 GLN n 1 29 ASN n 1 30 THR n 1 31 THR n 1 32 ALA n 1 33 GLU n 1 34 GLN n 1 35 GLU n 1 36 ALA n 1 37 LEU n 1 38 GLN n 1 39 ALA n 1 40 LYS n 1 41 VAL n 1 42 ASP n 1 43 ALA n 1 44 GLU n 1 45 ASN n 1 46 PHE n 1 47 TYR n 1 48 TYR n 1 49 VAL n 1 50 ILE n 1 51 LEU n 1 52 TYR n 1 53 LEU n 1 54 MET n 1 55 VAL n 1 56 MET n 1 57 ILE n 1 58 GLY n 1 59 MET n 1 60 PHE n 1 61 SER n 1 62 PHE n 1 63 ILE n 1 64 ILE n 1 65 VAL n 1 66 ALA n 1 67 ILE n 1 68 LEU n 1 69 VAL n 1 70 SER n 1 71 THR n 1 72 VAL n 1 73 LYS n 1 74 SER n 1 75 LYS n 1 76 ARG n 1 77 ARG n 1 78 GLU n 1 79 HIS n 1 80 SER n 1 81 ASN n 1 82 ASP n 1 83 PRO n 1 84 TYR n 1 85 HIS n 1 86 GLN n 1 87 TYR n 1 88 ILE n 1 89 VAL n 1 90 GLU n 1 91 ASP n 1 92 TRP n 1 93 GLN n 1 94 GLU n 1 95 LYS n 1 96 TYR n 1 97 LYS n 1 98 SER n 1 99 GLN n 1 100 ILE n 1 101 LEU n 1 102 ASN n 1 103 LEU n 1 104 GLU n 1 105 GLU n 1 106 SER n 1 107 LYS n 1 108 ALA n 1 109 THR n 1 110 ILE n 1 111 HIS n 1 112 GLU n 1 113 ASN n 1 114 ILE n 1 115 GLY n 1 116 ALA n 1 117 ALA n 1 118 GLY n 1 119 PHE n 1 120 LYS n 1 121 MET n 1 122 SER n 1 123 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene KCNE2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KCNE2_HUMAN _struct_ref.pdbx_db_accession Q9Y6J6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHS NDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M0Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y6J6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-15N HSQC' 1 3 3 '2D 1H-15N HSQC' 1 4 3 '3D HNCO' 1 5 3 '3D HNCA' 1 6 3 '3D HN(CO)CA' 1 7 3 '3D HNCACB' 1 8 3 '3D HN(COCA)CB' 1 9 2 '3D HBHA(CO)NH' 1 10 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-15N] KCNE2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.0 mM [U-13C; U-15N] KCNE2, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1.0 mM [U-13C; U-15N; U-2H] KCNE2, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DMX 1 'Bruker DMX' 800 Bruker DMX 2 'Bruker DMX' # _pdbx_nmr_refine.entry_id 2M0Q _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M0Q _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M0Q _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M0Q _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M0Q _struct.title 'Solution NMR analysis of intact KCNE2 in detergent micelles demonstrate a straight transmembrane helix' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M0Q _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Transmembrane helix, detergent micelle, Membrane protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 2 ? ALA A 39 ? SER A 2 ALA A 39 1 ? 38 HELX_P HELX_P2 2 ASN A 45 ? LYS A 75 ? ASN A 45 LYS A 75 1 ? 31 HELX_P HELX_P3 3 TYR A 87 ? GLY A 115 ? TYR A 87 GLY A 115 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2M0Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 PRO 123 123 123 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-30 2 'Structure model' 1 1 2021-11-17 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_database_2.pdbx_DOI' 13 2 'Structure model' '_database_2.pdbx_database_accession' 14 2 'Structure model' '_pdbx_nmr_software.name' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id KCNE2-1 1.0 ? mM '[U-15N]' 1 KCNE2-4 1.0 ? mM '[U-13C; U-15N]' 2 KCNE2-7 1.0 ? mM '[U-13C; U-15N; U-2H]' 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M0Q _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 282 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 130 _pdbx_nmr_constraints.NOE_long_range_total_count 0 _pdbx_nmr_constraints.NOE_medium_range_total_count 21 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 131 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 120 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 120 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 18 ? ? H A TYR 22 ? ? 1.54 2 1 O A ILE 67 ? ? H A THR 71 ? ? 1.56 3 1 O A GLN 34 ? ? H A GLN 38 ? ? 1.58 4 2 O A GLU 33 ? ? H A LEU 37 ? ? 1.57 5 3 O A ILE 18 ? ? H A TYR 22 ? ? 1.54 6 3 O A GLU 12 ? ? H A ARG 16 ? ? 1.59 7 4 O A ILE 18 ? ? H A TYR 22 ? ? 1.53 8 4 O A GLU 12 ? ? H A ARG 16 ? ? 1.57 9 5 O A ILE 18 ? ? H A TYR 22 ? ? 1.51 10 5 O A PHE 19 ? ? H A MET 23 ? ? 1.53 11 5 O A ARG 76 ? ? H A GLU 78 ? ? 1.55 12 6 O A ILE 18 ? ? H A TYR 22 ? ? 1.55 13 6 O A THR 31 ? ? H A GLU 35 ? ? 1.57 14 7 O A ILE 18 ? ? H A TYR 22 ? ? 1.54 15 7 O A VAL 49 ? ? H A LEU 53 ? ? 1.57 16 7 O A PHE 46 ? ? H A ILE 50 ? ? 1.58 17 7 O A GLU 12 ? ? H A ARG 16 ? ? 1.58 18 8 HG A SER 80 ? ? H A ASN 81 ? ? 1.30 19 8 O A ILE 18 ? ? H A TYR 22 ? ? 1.55 20 8 OD1 A ASN 81 ? ? H A ASP 82 ? ? 1.59 21 9 O A LEU 11 ? ? H A PHE 15 ? ? 1.55 22 9 O A ILE 18 ? ? H A TYR 22 ? ? 1.55 23 9 O A ARG 17 ? ? H A THR 21 ? ? 1.57 24 10 O A GLU 44 ? ? H A PHE 46 ? ? 1.57 25 10 O A GLU 12 ? ? H A ARG 16 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 41 ? ? 22.98 -132.50 2 1 ASN A 45 ? ? 69.09 -40.23 3 1 MET A 56 ? ? -64.99 -70.43 4 1 ARG A 77 ? ? 35.38 73.26 5 1 HIS A 85 ? ? -26.27 85.09 6 1 ALA A 117 ? ? -178.74 80.71 7 1 LYS A 120 ? ? -54.44 -130.77 8 2 VAL A 41 ? ? -87.44 49.87 9 2 ASP A 42 ? ? 64.17 -7.18 10 2 ASN A 45 ? ? 47.21 16.33 11 2 ALA A 117 ? ? 176.62 78.31 12 2 LYS A 120 ? ? 72.76 -142.58 13 3 VAL A 41 ? ? 25.12 38.68 14 3 ASP A 42 ? ? 21.88 83.24 15 3 ASN A 45 ? ? 68.12 -19.67 16 3 GLU A 78 ? ? 23.72 42.48 17 3 HIS A 79 ? ? 55.52 -177.62 18 3 ASN A 81 ? ? -165.44 -128.50 19 3 ALA A 117 ? ? -59.83 -4.56 20 3 LYS A 120 ? ? -173.13 30.21 21 4 VAL A 41 ? ? 26.70 35.26 22 4 ASP A 42 ? ? 29.91 61.60 23 4 ASN A 45 ? ? 66.09 -1.33 24 4 ARG A 77 ? ? 42.87 71.54 25 4 GLU A 78 ? ? 172.23 160.81 26 4 HIS A 85 ? ? 60.16 62.88 27 4 PHE A 119 ? ? -153.21 84.82 28 5 VAL A 41 ? ? -28.04 -36.85 29 5 ASP A 42 ? ? -84.82 48.30 30 5 ARG A 77 ? ? 67.06 -50.96 31 5 HIS A 79 ? ? -73.60 43.10 32 5 SER A 80 ? ? -37.89 155.08 33 5 ALA A 117 ? ? 179.67 -43.70 34 5 LYS A 120 ? ? -26.68 -69.13 35 6 ARG A 77 ? ? -132.37 -74.26 36 6 HIS A 79 ? ? -176.02 85.63 37 6 ASN A 81 ? ? -133.66 -31.91 38 6 HIS A 85 ? ? -55.72 77.22 39 6 ALA A 117 ? ? 77.47 -16.82 40 6 LYS A 120 ? ? -151.31 60.96 41 7 ASP A 42 ? ? 39.71 45.74 42 7 ARG A 76 ? ? -56.84 -6.94 43 7 GLU A 78 ? ? -79.47 -147.46 44 7 HIS A 79 ? ? -63.43 -143.01 45 7 HIS A 85 ? ? 79.96 -38.98 46 7 ALA A 117 ? ? -106.11 64.48 47 8 VAL A 41 ? ? -47.50 -15.55 48 8 ASP A 42 ? ? 64.36 62.76 49 8 ASN A 45 ? ? 26.70 92.09 50 8 ARG A 77 ? ? -152.47 87.63 51 8 GLU A 78 ? ? -176.03 92.23 52 8 SER A 80 ? ? -130.82 -120.60 53 8 ASN A 81 ? ? -149.03 -86.51 54 8 ALA A 117 ? ? 66.39 98.95 55 8 PHE A 119 ? ? -152.49 88.80 56 9 SER A 2 ? ? -108.75 79.24 57 9 VAL A 41 ? ? -74.52 34.87 58 9 ALA A 43 ? ? -52.61 -9.87 59 9 ASN A 45 ? ? -84.79 37.16 60 9 HIS A 79 ? ? -59.17 170.56 61 9 ASN A 81 ? ? -145.45 -49.51 62 9 HIS A 85 ? ? -176.08 -96.83 63 9 PHE A 119 ? ? -153.41 89.77 64 10 VAL A 41 ? ? -126.89 -166.67 65 10 ASP A 42 ? ? 23.42 51.70 66 10 ASN A 45 ? ? 66.18 -37.07 67 10 VAL A 55 ? ? -65.20 -73.65 68 10 HIS A 79 ? ? -59.16 175.04 69 10 SER A 80 ? ? 175.47 -119.97 70 10 ASN A 81 ? ? -69.85 56.99 71 10 HIS A 85 ? ? -161.24 66.61 72 10 ALA A 117 ? ? 70.13 103.05 73 10 LYS A 120 ? ? 35.02 29.29 #