data_2M33 # _entry.id 2M33 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M33 pdb_00002m33 10.2210/pdb2m33/pdb RCSB RCSB103147 ? ? BMRB 18919 ? ? WWPDB D_1000103147 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 18919 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M33 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-01-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Subramanian, V.' 1 'Ahuja, S.' 2 'Popovych, N.' 3 'Huang, R.' 4 'Le Clair, S.V.' 5 'Jahr, N.' 6 'Soong, R.' 7 'Xu, J.' 8 'Yamamoto, K.' 9 'Nanga, R.P.' 10 'Im, S.' 11 'Waskell, L.' 12 'Ramamoorthy, A.' 13 # _citation.id primary _citation.title 'NMR structure of full-length mammalian cytochrome b5' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ahuja, S.' 1 ? primary 'Subramanian, V.' 2 ? primary 'Popovych, N.' 3 ? primary 'Huang, R.' 4 ? primary 'Le Clair, S.V.' 5 ? primary 'Jahr, N.' 6 ? primary 'Soong, R.' 7 ? primary 'Xu, J.' 8 ? primary 'Yamamoto, K.' 9 ? primary 'Nanga, R.P.' 10 ? primary 'Im, S.' 11 ? primary 'Waskell, L.' 12 ? primary 'Ramamoorthy, A.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome b5' 15370.223 1 ? ? 'UNP residues 1-104' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFI IGELHPDDRSKLSKPMETLITTVDSNSSWWTNWVIPAISALIVALMYRLYMADD ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFI IGELHPDDRSKLSKPMETLITTVDSNSSWWTNWVIPAISALIVALMYRLYMADD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 GLN n 1 5 SER n 1 6 ASP n 1 7 LYS n 1 8 ASP n 1 9 VAL n 1 10 LYS n 1 11 TYR n 1 12 TYR n 1 13 THR n 1 14 LEU n 1 15 GLU n 1 16 GLU n 1 17 ILE n 1 18 LYS n 1 19 LYS n 1 20 HIS n 1 21 ASN n 1 22 HIS n 1 23 SER n 1 24 LYS n 1 25 SER n 1 26 THR n 1 27 TRP n 1 28 LEU n 1 29 ILE n 1 30 LEU n 1 31 HIS n 1 32 HIS n 1 33 LYS n 1 34 VAL n 1 35 TYR n 1 36 ASP n 1 37 LEU n 1 38 THR n 1 39 LYS n 1 40 PHE n 1 41 LEU n 1 42 GLU n 1 43 GLU n 1 44 HIS n 1 45 PRO n 1 46 GLY n 1 47 GLY n 1 48 GLU n 1 49 GLU n 1 50 VAL n 1 51 LEU n 1 52 ARG n 1 53 GLU n 1 54 GLN n 1 55 ALA n 1 56 GLY n 1 57 GLY n 1 58 ASP n 1 59 ALA n 1 60 THR n 1 61 GLU n 1 62 ASN n 1 63 PHE n 1 64 GLU n 1 65 ASP n 1 66 VAL n 1 67 GLY n 1 68 HIS n 1 69 SER n 1 70 THR n 1 71 ASP n 1 72 ALA n 1 73 ARG n 1 74 GLU n 1 75 LEU n 1 76 SER n 1 77 LYS n 1 78 THR n 1 79 PHE n 1 80 ILE n 1 81 ILE n 1 82 GLY n 1 83 GLU n 1 84 LEU n 1 85 HIS n 1 86 PRO n 1 87 ASP n 1 88 ASP n 1 89 ARG n 1 90 SER n 1 91 LYS n 1 92 LEU n 1 93 SER n 1 94 LYS n 1 95 PRO n 1 96 MET n 1 97 GLU n 1 98 THR n 1 99 LEU n 1 100 ILE n 1 101 THR n 1 102 THR n 1 103 VAL n 1 104 ASP n 1 105 SER n 1 106 ASN n 1 107 SER n 1 108 SER n 1 109 TRP n 1 110 TRP n 1 111 THR n 1 112 ASN n 1 113 TRP n 1 114 VAL n 1 115 ILE n 1 116 PRO n 1 117 ALA n 1 118 ILE n 1 119 SER n 1 120 ALA n 1 121 LEU n 1 122 ILE n 1 123 VAL n 1 124 ALA n 1 125 LEU n 1 126 MET n 1 127 TYR n 1 128 ARG n 1 129 LEU n 1 130 TYR n 1 131 MET n 1 132 ALA n 1 133 ASP n 1 134 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CYB5A, CYB5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_RABIT _struct_ref.pdbx_db_accession P00169 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFI IGELHPDDRSKLSKPMETLITTVDSNSSWWTNWVIPAISALIVALMYRLYMADD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M33 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00169 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 3 '2D 1H-1H NOESY' 1 4 2 '3D HNCO' 1 5 2 '3D HNCA' 1 6 2 '3D HNCACB' 1 7 2 '3D HN(CO)CA' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;45 mM [U-2H] DPC, 5 w/v glycerol, 100 mM potassium phosphate, 0.001 mM DSS, 0.1-0.5 mM [U-13C; U-15N] Cytochrome b5 full-length, 0.1-0.5 mM heme, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;45 mM [U-2H] DPC, 5 w/v glycerol, 100 mM potassium phosphate, 0.001 mM DSS, 0.1-0.5 mM [U-13C; U-15N; U-2H] Cytochrome b5 full-length, 0.1-0.5 mM heme, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;45 mM [U-2H] DPC, 5 w/v glycerol, 100 mM potassium phosphate, 0.001 mM DSS, 0.1-0.5 mM Cytochrome b5 full-length, 0.1-0.5 mM heme, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M33 _pdbx_nmr_refine.method 'distance geometry, torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 23 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M33 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.12 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.18 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M33 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 Goddard 'chemical shift assignment' Sparky 3.113 2 Goddard 'data analysis' Sparky 3.113 3 Goddard 'peak picking' Sparky 3.113 4 'Alexandre Bonvin' refinement HADDOCK ? 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M33 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M33 _struct.title 'Solution NMR structure of full-length oxidized microsomal rabbit cytochrome b5' _struct.pdbx_model_details 'minimized average structure, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2M33 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'membrane protein, heme, HADDOCK, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? LYS A 18 ? THR A 13 LYS A 18 1 ? 6 HELX_P HELX_P2 2 PHE A 40 ? HIS A 44 ? PHE A 40 HIS A 44 5 ? 5 HELX_P HELX_P3 3 GLU A 48 ? GLU A 53 ? GLU A 48 GLU A 53 1 ? 6 HELX_P HELX_P4 4 ALA A 59 ? GLY A 67 ? ALA A 59 GLY A 67 1 ? 9 HELX_P HELX_P5 5 SER A 69 ? SER A 76 ? SER A 69 SER A 76 1 ? 8 HELX_P HELX_P6 6 PRO A 86 ? ARG A 89 ? PRO A 86 ARG A 89 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 44 A HEM 400 1_555 ? ? ? ? ? ? ? 2.234 ? ? metalc2 metalc ? ? A HIS 68 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 68 A HEM 400 1_555 ? ? ? ? ? ? ? 2.265 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 10 ? TYR A 12 ? LYS A 10 TYR A 12 A 2 ILE A 80 ? LEU A 84 ? ILE A 80 LEU A 84 A 3 LYS A 33 ? ASP A 36 ? LYS A 33 ASP A 36 A 4 TRP A 27 ? LEU A 30 ? TRP A 27 LEU A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 12 ? N TYR A 12 O GLU A 83 ? O GLU A 83 A 2 3 O GLY A 82 ? O GLY A 82 N VAL A 34 ? N VAL A 34 A 3 4 O TYR A 35 ? O TYR A 35 N LEU A 28 ? N LEU A 28 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 400 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 400' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LEU A 30 ? LEU A 30 . ? 1_555 ? 2 AC1 8 LEU A 37 ? LEU A 37 . ? 1_555 ? 3 AC1 8 HIS A 44 ? HIS A 44 . ? 1_555 ? 4 AC1 8 PRO A 45 ? PRO A 45 . ? 1_555 ? 5 AC1 8 VAL A 50 ? VAL A 50 . ? 1_555 ? 6 AC1 8 VAL A 66 ? VAL A 66 . ? 1_555 ? 7 AC1 8 HIS A 68 ? HIS A 68 . ? 1_555 ? 8 AC1 8 SER A 69 ? SER A 69 . ? 1_555 ? # _atom_sites.entry_id 2M33 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 SER 105 105 ? ? ? A . n A 1 106 ASN 106 106 ? ? ? A . n A 1 107 SER 107 107 ? ? ? A . n A 1 108 SER 108 108 ? ? ? A . n A 1 109 TRP 109 109 ? ? ? A . n A 1 110 TRP 110 110 ? ? ? A . n A 1 111 THR 111 111 ? ? ? A . n A 1 112 ASN 112 112 ? ? ? A . n A 1 113 TRP 113 113 ? ? ? A . n A 1 114 VAL 114 114 ? ? ? A . n A 1 115 ILE 115 115 ? ? ? A . n A 1 116 PRO 116 116 ? ? ? A . n A 1 117 ALA 117 117 ? ? ? A . n A 1 118 ILE 118 118 ? ? ? A . n A 1 119 SER 119 119 ? ? ? A . n A 1 120 ALA 120 120 ? ? ? A . n A 1 121 LEU 121 121 ? ? ? A . n A 1 122 ILE 122 122 ? ? ? A . n A 1 123 VAL 123 123 ? ? ? A . n A 1 124 ALA 124 124 ? ? ? A . n A 1 125 LEU 125 125 ? ? ? A . n A 1 126 MET 126 126 ? ? ? A . n A 1 127 TYR 127 127 ? ? ? A . n A 1 128 ARG 128 128 ? ? ? A . n A 1 129 LEU 129 129 ? ? ? A . n A 1 130 TYR 130 130 ? ? ? A . n A 1 131 MET 131 131 ? ? ? A . n A 1 132 ALA 132 132 ? ? ? A . n A 1 133 ASP 133 133 ? ? ? A . n A 1 134 ASP 134 134 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 400 _pdbx_nonpoly_scheme.auth_seq_num 400 _pdbx_nonpoly_scheme.pdb_mon_id HEM _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NA ? B HEM . ? A HEM 400 ? 1_555 89.0 ? 2 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NB ? B HEM . ? A HEM 400 ? 1_555 88.7 ? 3 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NB ? B HEM . ? A HEM 400 ? 1_555 89.9 ? 4 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NC ? B HEM . ? A HEM 400 ? 1_555 88.9 ? 5 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NC ? B HEM . ? A HEM 400 ? 1_555 177.9 ? 6 NB ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NC ? B HEM . ? A HEM 400 ? 1_555 89.8 ? 7 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 88.8 ? 8 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 90.1 ? 9 NB ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 177.5 ? 10 NC ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 90.1 ? 11 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 174.7 ? 12 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 95.1 ? 13 NB ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 87.9 ? 14 NC ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 87.0 ? 15 ND ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 94.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-02-06 2 'Structure model' 1 1 2016-04-27 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.32 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.10 _pdbx_nmr_ensemble_rms.entry_id 2M33 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DPC-1 45 ? mM '[U-2H]' 1 glycerol-2 5 ? w/v ? 1 H2O-3 90 ? % ? 1 D2O-4 10 ? % '[U-2H]' 1 'potassium phosphate-5' 100 ? mM ? 1 DSS-6 0.001 ? mM ? 1 'Cytochrome b5 full-length-7' ? 0.1-0.5 mM '[U-13C; U-15N]' 1 heme-8 ? 0.1-0.5 mM ? 1 DPC-9 45 ? mM '[U-2H]' 2 glycerol-10 5 ? w/v ? 2 H2O-11 90 ? % ? 2 D2O-12 10 ? % '[U-2H]' 2 'potassium phosphate-13' 100 ? mM ? 2 DSS-14 0.001 ? mM ? 2 'Cytochrome b5 full-length-15' ? 0.1-0.5 mM '[U-13C; U-15N; U-2H]' 2 heme-16 ? 0.1-0.5 mM ? 2 DPC-17 45 ? mM '[U-2H]' 3 glycerol-18 5 ? w/v ? 3 H2O-19 90 ? % ? 3 D2O-20 10 ? % '[U-2H]' 3 'potassium phosphate-21' 100 ? mM ? 3 DSS-22 0.001 ? mM ? 3 'Cytochrome b5 full-length-23' ? 0.1-0.5 mM ? 3 heme-24 ? 0.1-0.5 mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M33 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1787 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 377 _pdbx_nmr_constraints.NOE_long_range_total_count 485 _pdbx_nmr_constraints.NOE_medium_range_total_count 412 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 513 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.60 2 2 HH11 A ARG 73 ? ? OE1 A GLU 74 ? ? 1.59 3 3 OD2 A ASP 88 ? ? HZ3 A LYS 94 ? ? 1.58 4 4 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.59 5 5 OE1 A GLU 83 ? ? HH22 A ARG 89 ? ? 1.58 6 7 OD1 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.58 7 7 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.59 8 8 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.55 9 8 OD1 A ASP 88 ? ? HZ3 A LYS 94 ? ? 1.56 10 8 OE1 A GLU 83 ? ? HH12 A ARG 89 ? ? 1.58 11 9 OD1 A ASP 88 ? ? HZ3 A LYS 94 ? ? 1.59 12 9 HZ1 A LYS 33 ? ? OE1 A GLU 83 ? ? 1.59 13 9 OE2 A GLU 83 ? ? HH22 A ARG 89 ? ? 1.60 14 10 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.58 15 11 HZ1 A LYS 33 ? ? OE2 A GLU 83 ? ? 1.54 16 11 OD1 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.60 17 12 HD1 A HIS 85 ? ? OD1 A ASP 88 ? ? 1.58 18 12 OD2 A ASP 88 ? ? HZ3 A LYS 94 ? ? 1.59 19 12 HE2 A HIS 31 ? ? OE2 A GLU 64 ? ? 1.59 20 12 OE1 A GLU 49 ? ? HH11 A ARG 52 ? ? 1.60 21 13 OD1 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.58 22 13 OE1 A GLU 48 ? ? HH21 A ARG 52 ? ? 1.60 23 13 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.60 24 16 OE1 A GLU 83 ? ? HH22 A ARG 89 ? ? 1.57 25 16 OD2 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.59 26 17 OD1 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.58 27 17 HH11 A ARG 73 ? ? OE2 A GLU 74 ? ? 1.58 28 18 OD2 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.59 29 20 OD1 A ASP 88 ? ? HZ3 A LYS 94 ? ? 1.58 30 20 HZ3 A LYS 33 ? ? OE2 A GLU 83 ? ? 1.59 31 21 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.56 32 21 OD2 A ASP 88 ? ? HZ2 A LYS 94 ? ? 1.56 33 22 OD1 A ASP 58 ? ? HG1 A THR 60 ? ? 1.57 34 22 OD1 A ASP 88 ? ? HZ3 A LYS 94 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -145.06 33.75 2 1 HIS A 22 ? ? -112.68 -76.31 3 1 SER A 23 ? ? -146.22 -50.80 4 1 SER A 25 ? ? -140.95 27.83 5 1 LEU A 37 ? ? -142.28 26.75 6 1 ARG A 89 ? ? -124.97 -64.74 7 1 LYS A 91 ? ? -156.54 -71.85 8 1 SER A 93 ? ? -101.63 54.99 9 1 GLU A 97 ? ? 59.59 92.49 10 2 HIS A 22 ? ? -114.60 -73.46 11 2 SER A 23 ? ? -151.47 -48.59 12 2 SER A 25 ? ? -150.11 29.65 13 2 LYS A 91 ? ? -161.78 -62.22 14 2 SER A 93 ? ? -112.98 70.93 15 2 GLU A 97 ? ? 59.85 94.64 16 3 ALA A 3 ? ? -144.20 32.91 17 3 SER A 5 ? ? -146.62 34.08 18 3 VAL A 9 ? ? -160.40 75.19 19 3 HIS A 22 ? ? -143.60 -66.96 20 3 SER A 23 ? ? -152.48 -59.66 21 3 SER A 25 ? ? -150.43 32.06 22 3 PRO A 45 ? ? -73.34 42.22 23 3 ARG A 89 ? ? -101.49 -70.96 24 3 SER A 90 ? ? -109.65 68.93 25 3 LYS A 91 ? ? -170.96 -72.59 26 3 MET A 96 ? ? -124.98 -73.42 27 3 GLU A 97 ? ? 65.37 102.17 28 4 HIS A 22 ? ? -105.13 -81.01 29 4 SER A 23 ? ? -133.77 -76.31 30 4 LYS A 24 ? ? -88.74 33.37 31 4 SER A 25 ? ? -151.49 32.93 32 4 THR A 26 ? ? -69.27 94.61 33 4 LYS A 91 ? ? -140.15 -66.15 34 4 MET A 96 ? ? -99.91 -66.85 35 4 GLU A 97 ? ? 65.12 111.21 36 5 HIS A 22 ? ? -147.90 -75.06 37 5 SER A 23 ? ? -148.56 -49.57 38 5 SER A 25 ? ? -154.72 41.16 39 5 LEU A 37 ? ? -144.28 27.22 40 5 LYS A 91 ? ? -123.36 -60.18 41 5 MET A 96 ? ? -129.52 -63.73 42 5 GLU A 97 ? ? 62.80 104.88 43 6 ALA A 2 ? ? -103.85 56.69 44 6 SER A 25 ? ? -154.67 41.59 45 6 PRO A 45 ? ? -69.22 79.52 46 6 ARG A 89 ? ? -132.25 -43.72 47 6 LYS A 91 ? ? -169.97 -69.87 48 6 MET A 96 ? ? -94.48 -67.99 49 6 GLU A 97 ? ? 68.52 125.15 50 7 SER A 25 ? ? -156.49 41.63 51 7 THR A 26 ? ? -63.40 98.96 52 7 GLU A 97 ? ? 65.94 106.24 53 8 SER A 25 ? ? -157.97 54.65 54 8 LEU A 37 ? ? -143.04 32.49 55 8 LYS A 91 ? ? -123.28 -62.10 56 8 GLU A 97 ? ? 68.25 104.09 57 9 ASN A 21 ? ? -55.00 102.06 58 9 SER A 25 ? ? -158.24 55.18 59 9 LYS A 91 ? ? -143.98 -66.02 60 9 SER A 93 ? ? -114.59 68.77 61 9 MET A 96 ? ? -117.51 -76.04 62 9 GLU A 97 ? ? 67.39 107.03 63 10 GLN A 4 ? ? -160.06 101.36 64 10 SER A 25 ? ? -162.02 96.27 65 10 MET A 96 ? ? -136.08 -54.07 66 10 GLU A 97 ? ? 58.92 88.95 67 10 VAL A 103 ? ? -140.37 32.23 68 11 SER A 25 ? ? -157.87 45.40 69 11 LYS A 91 ? ? -174.76 -61.24 70 11 SER A 93 ? ? -108.82 59.86 71 11 MET A 96 ? ? -106.13 -62.69 72 11 GLU A 97 ? ? 68.24 119.69 73 12 ASN A 21 ? ? -58.38 105.58 74 12 HIS A 22 ? ? -137.26 -88.90 75 12 SER A 23 ? ? -142.19 -43.84 76 12 SER A 25 ? ? -155.67 38.06 77 12 LYS A 91 ? ? -143.87 -63.11 78 12 SER A 93 ? ? -94.45 52.72 79 12 GLU A 97 ? ? 59.40 90.70 80 13 ALA A 3 ? ? -153.58 52.84 81 13 LYS A 7 ? ? -144.75 40.47 82 13 HIS A 22 ? ? -139.73 -87.40 83 13 SER A 23 ? ? -140.86 -56.95 84 13 SER A 25 ? ? -151.32 24.62 85 13 LEU A 37 ? ? -140.36 34.97 86 13 PRO A 45 ? ? -67.46 94.98 87 13 ARG A 89 ? ? -116.85 -73.05 88 13 MET A 96 ? ? -99.38 -72.51 89 13 GLU A 97 ? ? 65.61 99.43 90 14 ALA A 2 ? ? -115.45 63.87 91 14 SER A 25 ? ? -156.17 35.50 92 14 THR A 26 ? ? -68.13 97.54 93 14 LYS A 91 ? ? -164.93 -65.46 94 14 MET A 96 ? ? -102.12 -63.49 95 14 GLU A 97 ? ? 64.71 100.62 96 15 ASN A 21 ? ? -69.70 82.10 97 15 HIS A 22 ? ? -120.47 -78.01 98 15 SER A 23 ? ? -151.85 -47.72 99 15 SER A 25 ? ? -155.30 26.60 100 15 LEU A 37 ? ? -143.79 29.71 101 15 ARG A 89 ? ? -125.89 -64.94 102 15 SER A 90 ? ? -103.60 56.44 103 15 LYS A 91 ? ? -166.83 -67.59 104 15 MET A 96 ? ? -106.82 -74.00 105 15 GLU A 97 ? ? 61.59 89.09 106 16 ASN A 21 ? ? -69.06 85.94 107 16 HIS A 22 ? ? -136.93 -64.14 108 16 SER A 23 ? ? -150.47 -69.98 109 16 SER A 25 ? ? -159.48 23.62 110 16 LEU A 37 ? ? -142.78 30.47 111 16 LYS A 91 ? ? -166.02 -62.14 112 16 MET A 96 ? ? -95.99 -60.07 113 16 GLU A 97 ? ? 67.52 110.44 114 17 HIS A 22 ? ? -125.39 -84.48 115 17 SER A 23 ? ? -151.79 -46.17 116 17 SER A 25 ? ? -155.59 29.10 117 17 LYS A 91 ? ? -169.90 -64.09 118 17 MET A 96 ? ? -107.75 -64.80 119 17 GLU A 97 ? ? 61.68 103.14 120 18 SER A 5 ? ? -151.82 34.53 121 18 HIS A 22 ? ? -127.19 -82.07 122 18 SER A 23 ? ? -142.40 -48.19 123 18 SER A 25 ? ? -145.95 29.59 124 18 LEU A 37 ? ? -145.33 33.01 125 18 LYS A 91 ? ? -133.06 -60.59 126 18 MET A 96 ? ? -81.32 -71.96 127 18 GLU A 97 ? ? 63.91 104.93 128 19 HIS A 22 ? ? -102.96 -79.63 129 19 SER A 23 ? ? -150.08 -57.84 130 19 SER A 25 ? ? -155.80 22.58 131 19 LEU A 37 ? ? -148.94 30.77 132 19 LYS A 91 ? ? -142.46 -67.92 133 19 SER A 93 ? ? -86.71 43.16 134 19 MET A 96 ? ? -113.44 -78.88 135 19 GLU A 97 ? ? 66.06 111.60 136 19 VAL A 103 ? ? -85.67 37.85 137 20 ALA A 2 ? ? -146.21 48.82 138 20 SER A 25 ? ? -155.94 52.93 139 20 LEU A 37 ? ? -142.63 31.76 140 20 MET A 96 ? ? -81.83 -70.39 141 20 GLU A 97 ? ? 67.11 110.09 142 21 ALA A 2 ? ? -108.74 78.12 143 21 SER A 25 ? ? -160.68 46.64 144 21 ARG A 89 ? ? -105.71 -62.89 145 21 LYS A 91 ? ? -163.95 -60.15 146 21 MET A 96 ? ? -99.46 -73.28 147 21 GLU A 97 ? ? 66.01 100.77 148 22 LYS A 7 ? ? -142.67 41.88 149 22 HIS A 22 ? ? -114.88 -83.21 150 22 SER A 23 ? ? -148.48 -39.61 151 22 SER A 25 ? ? -151.81 31.38 152 22 LYS A 91 ? ? -164.84 -59.66 153 22 MET A 96 ? ? -125.67 -60.30 154 22 GLU A 97 ? ? 64.69 101.30 155 23 SER A 5 ? ? -117.01 63.82 156 23 ASN A 21 ? ? -69.98 95.46 157 23 HIS A 22 ? ? -131.98 -72.55 158 23 SER A 23 ? ? -147.32 -48.89 159 23 SER A 25 ? ? -154.49 30.98 160 23 ARG A 89 ? ? -123.78 -55.24 161 23 LYS A 91 ? ? -127.08 -67.05 162 23 SER A 93 ? ? -91.25 48.58 163 23 MET A 96 ? ? -115.70 -71.12 164 23 GLU A 97 ? ? 66.38 120.42 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 105 ? A SER 105 2 1 Y 1 A ASN 106 ? A ASN 106 3 1 Y 1 A SER 107 ? A SER 107 4 1 Y 1 A SER 108 ? A SER 108 5 1 Y 1 A TRP 109 ? A TRP 109 6 1 Y 1 A TRP 110 ? A TRP 110 7 1 Y 1 A THR 111 ? A THR 111 8 1 Y 1 A ASN 112 ? A ASN 112 9 1 Y 1 A TRP 113 ? A TRP 113 10 1 Y 1 A VAL 114 ? A VAL 114 11 1 Y 1 A ILE 115 ? A ILE 115 12 1 Y 1 A PRO 116 ? A PRO 116 13 1 Y 1 A ALA 117 ? A ALA 117 14 1 Y 1 A ILE 118 ? A ILE 118 15 1 Y 1 A SER 119 ? A SER 119 16 1 Y 1 A ALA 120 ? A ALA 120 17 1 Y 1 A LEU 121 ? A LEU 121 18 1 Y 1 A ILE 122 ? A ILE 122 19 1 Y 1 A VAL 123 ? A VAL 123 20 1 Y 1 A ALA 124 ? A ALA 124 21 1 Y 1 A LEU 125 ? A LEU 125 22 1 Y 1 A MET 126 ? A MET 126 23 1 Y 1 A TYR 127 ? A TYR 127 24 1 Y 1 A ARG 128 ? A ARG 128 25 1 Y 1 A LEU 129 ? A LEU 129 26 1 Y 1 A TYR 130 ? A TYR 130 27 1 Y 1 A MET 131 ? A MET 131 28 1 Y 1 A ALA 132 ? A ALA 132 29 1 Y 1 A ASP 133 ? A ASP 133 30 1 Y 1 A ASP 134 ? A ASP 134 31 2 Y 1 A SER 105 ? A SER 105 32 2 Y 1 A ASN 106 ? A ASN 106 33 2 Y 1 A SER 107 ? A SER 107 34 2 Y 1 A SER 108 ? A SER 108 35 2 Y 1 A TRP 109 ? A TRP 109 36 2 Y 1 A TRP 110 ? A TRP 110 37 2 Y 1 A THR 111 ? A THR 111 38 2 Y 1 A ASN 112 ? A ASN 112 39 2 Y 1 A TRP 113 ? A TRP 113 40 2 Y 1 A VAL 114 ? A VAL 114 41 2 Y 1 A ILE 115 ? A ILE 115 42 2 Y 1 A PRO 116 ? A PRO 116 43 2 Y 1 A ALA 117 ? A ALA 117 44 2 Y 1 A ILE 118 ? A ILE 118 45 2 Y 1 A SER 119 ? A SER 119 46 2 Y 1 A ALA 120 ? A ALA 120 47 2 Y 1 A LEU 121 ? A LEU 121 48 2 Y 1 A ILE 122 ? A ILE 122 49 2 Y 1 A VAL 123 ? A VAL 123 50 2 Y 1 A ALA 124 ? A ALA 124 51 2 Y 1 A LEU 125 ? A LEU 125 52 2 Y 1 A MET 126 ? A MET 126 53 2 Y 1 A TYR 127 ? A TYR 127 54 2 Y 1 A ARG 128 ? A ARG 128 55 2 Y 1 A LEU 129 ? A LEU 129 56 2 Y 1 A TYR 130 ? A TYR 130 57 2 Y 1 A MET 131 ? A MET 131 58 2 Y 1 A ALA 132 ? A ALA 132 59 2 Y 1 A ASP 133 ? A ASP 133 60 2 Y 1 A ASP 134 ? A ASP 134 61 3 Y 1 A SER 105 ? A SER 105 62 3 Y 1 A ASN 106 ? A ASN 106 63 3 Y 1 A SER 107 ? A SER 107 64 3 Y 1 A SER 108 ? A SER 108 65 3 Y 1 A TRP 109 ? A TRP 109 66 3 Y 1 A TRP 110 ? A TRP 110 67 3 Y 1 A THR 111 ? A THR 111 68 3 Y 1 A ASN 112 ? A ASN 112 69 3 Y 1 A TRP 113 ? A TRP 113 70 3 Y 1 A VAL 114 ? A VAL 114 71 3 Y 1 A ILE 115 ? A ILE 115 72 3 Y 1 A PRO 116 ? A PRO 116 73 3 Y 1 A ALA 117 ? A ALA 117 74 3 Y 1 A ILE 118 ? A ILE 118 75 3 Y 1 A SER 119 ? A SER 119 76 3 Y 1 A ALA 120 ? A ALA 120 77 3 Y 1 A LEU 121 ? A LEU 121 78 3 Y 1 A ILE 122 ? A ILE 122 79 3 Y 1 A VAL 123 ? A VAL 123 80 3 Y 1 A ALA 124 ? A ALA 124 81 3 Y 1 A LEU 125 ? A LEU 125 82 3 Y 1 A MET 126 ? A MET 126 83 3 Y 1 A TYR 127 ? A TYR 127 84 3 Y 1 A ARG 128 ? A ARG 128 85 3 Y 1 A LEU 129 ? A LEU 129 86 3 Y 1 A TYR 130 ? A TYR 130 87 3 Y 1 A MET 131 ? A MET 131 88 3 Y 1 A ALA 132 ? A ALA 132 89 3 Y 1 A ASP 133 ? A ASP 133 90 3 Y 1 A ASP 134 ? A ASP 134 91 4 Y 1 A SER 105 ? A SER 105 92 4 Y 1 A ASN 106 ? A ASN 106 93 4 Y 1 A SER 107 ? A SER 107 94 4 Y 1 A SER 108 ? A SER 108 95 4 Y 1 A TRP 109 ? A TRP 109 96 4 Y 1 A TRP 110 ? A TRP 110 97 4 Y 1 A THR 111 ? A THR 111 98 4 Y 1 A ASN 112 ? A ASN 112 99 4 Y 1 A TRP 113 ? A TRP 113 100 4 Y 1 A VAL 114 ? A VAL 114 101 4 Y 1 A ILE 115 ? A ILE 115 102 4 Y 1 A PRO 116 ? A PRO 116 103 4 Y 1 A ALA 117 ? A ALA 117 104 4 Y 1 A ILE 118 ? A ILE 118 105 4 Y 1 A SER 119 ? A SER 119 106 4 Y 1 A ALA 120 ? A ALA 120 107 4 Y 1 A LEU 121 ? A LEU 121 108 4 Y 1 A ILE 122 ? A ILE 122 109 4 Y 1 A VAL 123 ? A VAL 123 110 4 Y 1 A ALA 124 ? A ALA 124 111 4 Y 1 A LEU 125 ? A LEU 125 112 4 Y 1 A MET 126 ? A MET 126 113 4 Y 1 A TYR 127 ? A TYR 127 114 4 Y 1 A ARG 128 ? A ARG 128 115 4 Y 1 A LEU 129 ? A LEU 129 116 4 Y 1 A TYR 130 ? A TYR 130 117 4 Y 1 A MET 131 ? A MET 131 118 4 Y 1 A ALA 132 ? A ALA 132 119 4 Y 1 A ASP 133 ? A ASP 133 120 4 Y 1 A ASP 134 ? A ASP 134 121 5 Y 1 A SER 105 ? A SER 105 122 5 Y 1 A ASN 106 ? A ASN 106 123 5 Y 1 A SER 107 ? A SER 107 124 5 Y 1 A SER 108 ? A SER 108 125 5 Y 1 A TRP 109 ? A TRP 109 126 5 Y 1 A TRP 110 ? A TRP 110 127 5 Y 1 A THR 111 ? A THR 111 128 5 Y 1 A ASN 112 ? A ASN 112 129 5 Y 1 A TRP 113 ? A TRP 113 130 5 Y 1 A VAL 114 ? A VAL 114 131 5 Y 1 A ILE 115 ? A ILE 115 132 5 Y 1 A PRO 116 ? A PRO 116 133 5 Y 1 A ALA 117 ? A ALA 117 134 5 Y 1 A ILE 118 ? A ILE 118 135 5 Y 1 A SER 119 ? A SER 119 136 5 Y 1 A ALA 120 ? A ALA 120 137 5 Y 1 A LEU 121 ? A LEU 121 138 5 Y 1 A ILE 122 ? A ILE 122 139 5 Y 1 A VAL 123 ? A VAL 123 140 5 Y 1 A ALA 124 ? A ALA 124 141 5 Y 1 A LEU 125 ? A LEU 125 142 5 Y 1 A MET 126 ? A MET 126 143 5 Y 1 A TYR 127 ? A TYR 127 144 5 Y 1 A ARG 128 ? A ARG 128 145 5 Y 1 A LEU 129 ? A LEU 129 146 5 Y 1 A TYR 130 ? A TYR 130 147 5 Y 1 A MET 131 ? A MET 131 148 5 Y 1 A ALA 132 ? A ALA 132 149 5 Y 1 A ASP 133 ? A ASP 133 150 5 Y 1 A ASP 134 ? A ASP 134 151 6 Y 1 A SER 105 ? A SER 105 152 6 Y 1 A ASN 106 ? A ASN 106 153 6 Y 1 A SER 107 ? A SER 107 154 6 Y 1 A SER 108 ? A SER 108 155 6 Y 1 A TRP 109 ? A TRP 109 156 6 Y 1 A TRP 110 ? A TRP 110 157 6 Y 1 A THR 111 ? A THR 111 158 6 Y 1 A ASN 112 ? A ASN 112 159 6 Y 1 A TRP 113 ? A TRP 113 160 6 Y 1 A VAL 114 ? A VAL 114 161 6 Y 1 A ILE 115 ? A ILE 115 162 6 Y 1 A PRO 116 ? A PRO 116 163 6 Y 1 A ALA 117 ? A ALA 117 164 6 Y 1 A ILE 118 ? A ILE 118 165 6 Y 1 A SER 119 ? A SER 119 166 6 Y 1 A ALA 120 ? A ALA 120 167 6 Y 1 A LEU 121 ? A LEU 121 168 6 Y 1 A ILE 122 ? A ILE 122 169 6 Y 1 A VAL 123 ? A VAL 123 170 6 Y 1 A ALA 124 ? A ALA 124 171 6 Y 1 A LEU 125 ? A LEU 125 172 6 Y 1 A MET 126 ? A MET 126 173 6 Y 1 A TYR 127 ? A TYR 127 174 6 Y 1 A ARG 128 ? A ARG 128 175 6 Y 1 A LEU 129 ? A LEU 129 176 6 Y 1 A TYR 130 ? A TYR 130 177 6 Y 1 A MET 131 ? A MET 131 178 6 Y 1 A ALA 132 ? A ALA 132 179 6 Y 1 A ASP 133 ? A ASP 133 180 6 Y 1 A ASP 134 ? A ASP 134 181 7 Y 1 A SER 105 ? A SER 105 182 7 Y 1 A ASN 106 ? A ASN 106 183 7 Y 1 A SER 107 ? A SER 107 184 7 Y 1 A SER 108 ? A SER 108 185 7 Y 1 A TRP 109 ? A TRP 109 186 7 Y 1 A TRP 110 ? A TRP 110 187 7 Y 1 A THR 111 ? A THR 111 188 7 Y 1 A ASN 112 ? A ASN 112 189 7 Y 1 A TRP 113 ? A TRP 113 190 7 Y 1 A VAL 114 ? A VAL 114 191 7 Y 1 A ILE 115 ? A ILE 115 192 7 Y 1 A PRO 116 ? A PRO 116 193 7 Y 1 A ALA 117 ? A ALA 117 194 7 Y 1 A ILE 118 ? A ILE 118 195 7 Y 1 A SER 119 ? A SER 119 196 7 Y 1 A ALA 120 ? A ALA 120 197 7 Y 1 A LEU 121 ? A LEU 121 198 7 Y 1 A ILE 122 ? A ILE 122 199 7 Y 1 A VAL 123 ? A VAL 123 200 7 Y 1 A ALA 124 ? A ALA 124 201 7 Y 1 A LEU 125 ? A LEU 125 202 7 Y 1 A MET 126 ? A MET 126 203 7 Y 1 A TYR 127 ? A TYR 127 204 7 Y 1 A ARG 128 ? A ARG 128 205 7 Y 1 A LEU 129 ? A LEU 129 206 7 Y 1 A TYR 130 ? A TYR 130 207 7 Y 1 A MET 131 ? A MET 131 208 7 Y 1 A ALA 132 ? A ALA 132 209 7 Y 1 A ASP 133 ? A ASP 133 210 7 Y 1 A ASP 134 ? A ASP 134 211 8 Y 1 A SER 105 ? A SER 105 212 8 Y 1 A ASN 106 ? A ASN 106 213 8 Y 1 A SER 107 ? A SER 107 214 8 Y 1 A SER 108 ? A SER 108 215 8 Y 1 A TRP 109 ? A TRP 109 216 8 Y 1 A TRP 110 ? A TRP 110 217 8 Y 1 A THR 111 ? A THR 111 218 8 Y 1 A ASN 112 ? A ASN 112 219 8 Y 1 A TRP 113 ? A TRP 113 220 8 Y 1 A VAL 114 ? A VAL 114 221 8 Y 1 A ILE 115 ? A ILE 115 222 8 Y 1 A PRO 116 ? A PRO 116 223 8 Y 1 A ALA 117 ? A ALA 117 224 8 Y 1 A ILE 118 ? A ILE 118 225 8 Y 1 A SER 119 ? A SER 119 226 8 Y 1 A ALA 120 ? A ALA 120 227 8 Y 1 A LEU 121 ? A LEU 121 228 8 Y 1 A ILE 122 ? A ILE 122 229 8 Y 1 A VAL 123 ? A VAL 123 230 8 Y 1 A ALA 124 ? A ALA 124 231 8 Y 1 A LEU 125 ? A LEU 125 232 8 Y 1 A MET 126 ? A MET 126 233 8 Y 1 A TYR 127 ? A TYR 127 234 8 Y 1 A ARG 128 ? A ARG 128 235 8 Y 1 A LEU 129 ? A LEU 129 236 8 Y 1 A TYR 130 ? A TYR 130 237 8 Y 1 A MET 131 ? A MET 131 238 8 Y 1 A ALA 132 ? A ALA 132 239 8 Y 1 A ASP 133 ? A ASP 133 240 8 Y 1 A ASP 134 ? A ASP 134 241 9 Y 1 A SER 105 ? A SER 105 242 9 Y 1 A ASN 106 ? A ASN 106 243 9 Y 1 A SER 107 ? A SER 107 244 9 Y 1 A SER 108 ? A SER 108 245 9 Y 1 A TRP 109 ? A TRP 109 246 9 Y 1 A TRP 110 ? A TRP 110 247 9 Y 1 A THR 111 ? A THR 111 248 9 Y 1 A ASN 112 ? A ASN 112 249 9 Y 1 A TRP 113 ? A TRP 113 250 9 Y 1 A VAL 114 ? A VAL 114 251 9 Y 1 A ILE 115 ? A ILE 115 252 9 Y 1 A PRO 116 ? A PRO 116 253 9 Y 1 A ALA 117 ? A ALA 117 254 9 Y 1 A ILE 118 ? A ILE 118 255 9 Y 1 A SER 119 ? A SER 119 256 9 Y 1 A ALA 120 ? A ALA 120 257 9 Y 1 A LEU 121 ? A LEU 121 258 9 Y 1 A ILE 122 ? A ILE 122 259 9 Y 1 A VAL 123 ? A VAL 123 260 9 Y 1 A ALA 124 ? A ALA 124 261 9 Y 1 A LEU 125 ? A LEU 125 262 9 Y 1 A MET 126 ? A MET 126 263 9 Y 1 A TYR 127 ? A TYR 127 264 9 Y 1 A ARG 128 ? A ARG 128 265 9 Y 1 A LEU 129 ? A LEU 129 266 9 Y 1 A TYR 130 ? A TYR 130 267 9 Y 1 A MET 131 ? A MET 131 268 9 Y 1 A ALA 132 ? A ALA 132 269 9 Y 1 A ASP 133 ? A ASP 133 270 9 Y 1 A ASP 134 ? A ASP 134 271 10 Y 1 A SER 105 ? A SER 105 272 10 Y 1 A ASN 106 ? A ASN 106 273 10 Y 1 A SER 107 ? A SER 107 274 10 Y 1 A SER 108 ? A SER 108 275 10 Y 1 A TRP 109 ? A TRP 109 276 10 Y 1 A TRP 110 ? A TRP 110 277 10 Y 1 A THR 111 ? A THR 111 278 10 Y 1 A ASN 112 ? A ASN 112 279 10 Y 1 A TRP 113 ? A TRP 113 280 10 Y 1 A VAL 114 ? A VAL 114 281 10 Y 1 A ILE 115 ? A ILE 115 282 10 Y 1 A PRO 116 ? A PRO 116 283 10 Y 1 A ALA 117 ? A ALA 117 284 10 Y 1 A ILE 118 ? A ILE 118 285 10 Y 1 A SER 119 ? A SER 119 286 10 Y 1 A ALA 120 ? A ALA 120 287 10 Y 1 A LEU 121 ? A LEU 121 288 10 Y 1 A ILE 122 ? A ILE 122 289 10 Y 1 A VAL 123 ? A VAL 123 290 10 Y 1 A ALA 124 ? A ALA 124 291 10 Y 1 A LEU 125 ? A LEU 125 292 10 Y 1 A MET 126 ? A MET 126 293 10 Y 1 A TYR 127 ? A TYR 127 294 10 Y 1 A ARG 128 ? A ARG 128 295 10 Y 1 A LEU 129 ? A LEU 129 296 10 Y 1 A TYR 130 ? A TYR 130 297 10 Y 1 A MET 131 ? A MET 131 298 10 Y 1 A ALA 132 ? A ALA 132 299 10 Y 1 A ASP 133 ? A ASP 133 300 10 Y 1 A ASP 134 ? A ASP 134 301 11 Y 1 A SER 105 ? A SER 105 302 11 Y 1 A ASN 106 ? A ASN 106 303 11 Y 1 A SER 107 ? A SER 107 304 11 Y 1 A SER 108 ? A SER 108 305 11 Y 1 A TRP 109 ? A TRP 109 306 11 Y 1 A TRP 110 ? A TRP 110 307 11 Y 1 A THR 111 ? A THR 111 308 11 Y 1 A ASN 112 ? A ASN 112 309 11 Y 1 A TRP 113 ? A TRP 113 310 11 Y 1 A VAL 114 ? A VAL 114 311 11 Y 1 A ILE 115 ? A ILE 115 312 11 Y 1 A PRO 116 ? A PRO 116 313 11 Y 1 A ALA 117 ? A ALA 117 314 11 Y 1 A ILE 118 ? A ILE 118 315 11 Y 1 A SER 119 ? A SER 119 316 11 Y 1 A ALA 120 ? A ALA 120 317 11 Y 1 A LEU 121 ? A LEU 121 318 11 Y 1 A ILE 122 ? A ILE 122 319 11 Y 1 A VAL 123 ? A VAL 123 320 11 Y 1 A ALA 124 ? A ALA 124 321 11 Y 1 A LEU 125 ? A LEU 125 322 11 Y 1 A MET 126 ? A MET 126 323 11 Y 1 A TYR 127 ? A TYR 127 324 11 Y 1 A ARG 128 ? A ARG 128 325 11 Y 1 A LEU 129 ? A LEU 129 326 11 Y 1 A TYR 130 ? A TYR 130 327 11 Y 1 A MET 131 ? A MET 131 328 11 Y 1 A ALA 132 ? A ALA 132 329 11 Y 1 A ASP 133 ? A ASP 133 330 11 Y 1 A ASP 134 ? A ASP 134 331 12 Y 1 A SER 105 ? A SER 105 332 12 Y 1 A ASN 106 ? A ASN 106 333 12 Y 1 A SER 107 ? A SER 107 334 12 Y 1 A SER 108 ? A SER 108 335 12 Y 1 A TRP 109 ? A TRP 109 336 12 Y 1 A TRP 110 ? A TRP 110 337 12 Y 1 A THR 111 ? A THR 111 338 12 Y 1 A ASN 112 ? A ASN 112 339 12 Y 1 A TRP 113 ? A TRP 113 340 12 Y 1 A VAL 114 ? A VAL 114 341 12 Y 1 A ILE 115 ? A ILE 115 342 12 Y 1 A PRO 116 ? A PRO 116 343 12 Y 1 A ALA 117 ? A ALA 117 344 12 Y 1 A ILE 118 ? A ILE 118 345 12 Y 1 A SER 119 ? A SER 119 346 12 Y 1 A ALA 120 ? A ALA 120 347 12 Y 1 A LEU 121 ? A LEU 121 348 12 Y 1 A ILE 122 ? A ILE 122 349 12 Y 1 A VAL 123 ? A VAL 123 350 12 Y 1 A ALA 124 ? A ALA 124 351 12 Y 1 A LEU 125 ? A LEU 125 352 12 Y 1 A MET 126 ? A MET 126 353 12 Y 1 A TYR 127 ? A TYR 127 354 12 Y 1 A ARG 128 ? A ARG 128 355 12 Y 1 A LEU 129 ? A LEU 129 356 12 Y 1 A TYR 130 ? A TYR 130 357 12 Y 1 A MET 131 ? A MET 131 358 12 Y 1 A ALA 132 ? A ALA 132 359 12 Y 1 A ASP 133 ? A ASP 133 360 12 Y 1 A ASP 134 ? A ASP 134 361 13 Y 1 A SER 105 ? A SER 105 362 13 Y 1 A ASN 106 ? A ASN 106 363 13 Y 1 A SER 107 ? A SER 107 364 13 Y 1 A SER 108 ? A SER 108 365 13 Y 1 A TRP 109 ? A TRP 109 366 13 Y 1 A TRP 110 ? A TRP 110 367 13 Y 1 A THR 111 ? A THR 111 368 13 Y 1 A ASN 112 ? A ASN 112 369 13 Y 1 A TRP 113 ? A TRP 113 370 13 Y 1 A VAL 114 ? A VAL 114 371 13 Y 1 A ILE 115 ? A ILE 115 372 13 Y 1 A PRO 116 ? A PRO 116 373 13 Y 1 A ALA 117 ? A ALA 117 374 13 Y 1 A ILE 118 ? A ILE 118 375 13 Y 1 A SER 119 ? A SER 119 376 13 Y 1 A ALA 120 ? A ALA 120 377 13 Y 1 A LEU 121 ? A LEU 121 378 13 Y 1 A ILE 122 ? A ILE 122 379 13 Y 1 A VAL 123 ? A VAL 123 380 13 Y 1 A ALA 124 ? A ALA 124 381 13 Y 1 A LEU 125 ? A LEU 125 382 13 Y 1 A MET 126 ? A MET 126 383 13 Y 1 A TYR 127 ? A TYR 127 384 13 Y 1 A ARG 128 ? A ARG 128 385 13 Y 1 A LEU 129 ? A LEU 129 386 13 Y 1 A TYR 130 ? A TYR 130 387 13 Y 1 A MET 131 ? A MET 131 388 13 Y 1 A ALA 132 ? A ALA 132 389 13 Y 1 A ASP 133 ? A ASP 133 390 13 Y 1 A ASP 134 ? A ASP 134 391 14 Y 1 A SER 105 ? A SER 105 392 14 Y 1 A ASN 106 ? A ASN 106 393 14 Y 1 A SER 107 ? A SER 107 394 14 Y 1 A SER 108 ? A SER 108 395 14 Y 1 A TRP 109 ? A TRP 109 396 14 Y 1 A TRP 110 ? A TRP 110 397 14 Y 1 A THR 111 ? A THR 111 398 14 Y 1 A ASN 112 ? A ASN 112 399 14 Y 1 A TRP 113 ? A TRP 113 400 14 Y 1 A VAL 114 ? A VAL 114 401 14 Y 1 A ILE 115 ? A ILE 115 402 14 Y 1 A PRO 116 ? A PRO 116 403 14 Y 1 A ALA 117 ? A ALA 117 404 14 Y 1 A ILE 118 ? A ILE 118 405 14 Y 1 A SER 119 ? A SER 119 406 14 Y 1 A ALA 120 ? A ALA 120 407 14 Y 1 A LEU 121 ? A LEU 121 408 14 Y 1 A ILE 122 ? A ILE 122 409 14 Y 1 A VAL 123 ? A VAL 123 410 14 Y 1 A ALA 124 ? A ALA 124 411 14 Y 1 A LEU 125 ? A LEU 125 412 14 Y 1 A MET 126 ? A MET 126 413 14 Y 1 A TYR 127 ? A TYR 127 414 14 Y 1 A ARG 128 ? A ARG 128 415 14 Y 1 A LEU 129 ? A LEU 129 416 14 Y 1 A TYR 130 ? A TYR 130 417 14 Y 1 A MET 131 ? A MET 131 418 14 Y 1 A ALA 132 ? A ALA 132 419 14 Y 1 A ASP 133 ? A ASP 133 420 14 Y 1 A ASP 134 ? A ASP 134 421 15 Y 1 A SER 105 ? A SER 105 422 15 Y 1 A ASN 106 ? A ASN 106 423 15 Y 1 A SER 107 ? A SER 107 424 15 Y 1 A SER 108 ? A SER 108 425 15 Y 1 A TRP 109 ? A TRP 109 426 15 Y 1 A TRP 110 ? A TRP 110 427 15 Y 1 A THR 111 ? A THR 111 428 15 Y 1 A ASN 112 ? A ASN 112 429 15 Y 1 A TRP 113 ? A TRP 113 430 15 Y 1 A VAL 114 ? A VAL 114 431 15 Y 1 A ILE 115 ? A ILE 115 432 15 Y 1 A PRO 116 ? A PRO 116 433 15 Y 1 A ALA 117 ? A ALA 117 434 15 Y 1 A ILE 118 ? A ILE 118 435 15 Y 1 A SER 119 ? A SER 119 436 15 Y 1 A ALA 120 ? A ALA 120 437 15 Y 1 A LEU 121 ? A LEU 121 438 15 Y 1 A ILE 122 ? A ILE 122 439 15 Y 1 A VAL 123 ? A VAL 123 440 15 Y 1 A ALA 124 ? A ALA 124 441 15 Y 1 A LEU 125 ? A LEU 125 442 15 Y 1 A MET 126 ? A MET 126 443 15 Y 1 A TYR 127 ? A TYR 127 444 15 Y 1 A ARG 128 ? A ARG 128 445 15 Y 1 A LEU 129 ? A LEU 129 446 15 Y 1 A TYR 130 ? A TYR 130 447 15 Y 1 A MET 131 ? A MET 131 448 15 Y 1 A ALA 132 ? A ALA 132 449 15 Y 1 A ASP 133 ? A ASP 133 450 15 Y 1 A ASP 134 ? A ASP 134 451 16 Y 1 A SER 105 ? A SER 105 452 16 Y 1 A ASN 106 ? A ASN 106 453 16 Y 1 A SER 107 ? A SER 107 454 16 Y 1 A SER 108 ? A SER 108 455 16 Y 1 A TRP 109 ? A TRP 109 456 16 Y 1 A TRP 110 ? A TRP 110 457 16 Y 1 A THR 111 ? A THR 111 458 16 Y 1 A ASN 112 ? A ASN 112 459 16 Y 1 A TRP 113 ? A TRP 113 460 16 Y 1 A VAL 114 ? A VAL 114 461 16 Y 1 A ILE 115 ? A ILE 115 462 16 Y 1 A PRO 116 ? A PRO 116 463 16 Y 1 A ALA 117 ? A ALA 117 464 16 Y 1 A ILE 118 ? A ILE 118 465 16 Y 1 A SER 119 ? A SER 119 466 16 Y 1 A ALA 120 ? A ALA 120 467 16 Y 1 A LEU 121 ? A LEU 121 468 16 Y 1 A ILE 122 ? A ILE 122 469 16 Y 1 A VAL 123 ? A VAL 123 470 16 Y 1 A ALA 124 ? A ALA 124 471 16 Y 1 A LEU 125 ? A LEU 125 472 16 Y 1 A MET 126 ? A MET 126 473 16 Y 1 A TYR 127 ? A TYR 127 474 16 Y 1 A ARG 128 ? A ARG 128 475 16 Y 1 A LEU 129 ? A LEU 129 476 16 Y 1 A TYR 130 ? A TYR 130 477 16 Y 1 A MET 131 ? A MET 131 478 16 Y 1 A ALA 132 ? A ALA 132 479 16 Y 1 A ASP 133 ? A ASP 133 480 16 Y 1 A ASP 134 ? A ASP 134 481 17 Y 1 A SER 105 ? A SER 105 482 17 Y 1 A ASN 106 ? A ASN 106 483 17 Y 1 A SER 107 ? A SER 107 484 17 Y 1 A SER 108 ? A SER 108 485 17 Y 1 A TRP 109 ? A TRP 109 486 17 Y 1 A TRP 110 ? A TRP 110 487 17 Y 1 A THR 111 ? A THR 111 488 17 Y 1 A ASN 112 ? A ASN 112 489 17 Y 1 A TRP 113 ? A TRP 113 490 17 Y 1 A VAL 114 ? A VAL 114 491 17 Y 1 A ILE 115 ? A ILE 115 492 17 Y 1 A PRO 116 ? A PRO 116 493 17 Y 1 A ALA 117 ? A ALA 117 494 17 Y 1 A ILE 118 ? A ILE 118 495 17 Y 1 A SER 119 ? A SER 119 496 17 Y 1 A ALA 120 ? A ALA 120 497 17 Y 1 A LEU 121 ? A LEU 121 498 17 Y 1 A ILE 122 ? A ILE 122 499 17 Y 1 A VAL 123 ? A VAL 123 500 17 Y 1 A ALA 124 ? A ALA 124 501 17 Y 1 A LEU 125 ? A LEU 125 502 17 Y 1 A MET 126 ? A MET 126 503 17 Y 1 A TYR 127 ? A TYR 127 504 17 Y 1 A ARG 128 ? A ARG 128 505 17 Y 1 A LEU 129 ? A LEU 129 506 17 Y 1 A TYR 130 ? A TYR 130 507 17 Y 1 A MET 131 ? A MET 131 508 17 Y 1 A ALA 132 ? A ALA 132 509 17 Y 1 A ASP 133 ? A ASP 133 510 17 Y 1 A ASP 134 ? A ASP 134 511 18 Y 1 A SER 105 ? A SER 105 512 18 Y 1 A ASN 106 ? A ASN 106 513 18 Y 1 A SER 107 ? A SER 107 514 18 Y 1 A SER 108 ? A SER 108 515 18 Y 1 A TRP 109 ? A TRP 109 516 18 Y 1 A TRP 110 ? A TRP 110 517 18 Y 1 A THR 111 ? A THR 111 518 18 Y 1 A ASN 112 ? A ASN 112 519 18 Y 1 A TRP 113 ? A TRP 113 520 18 Y 1 A VAL 114 ? A VAL 114 521 18 Y 1 A ILE 115 ? A ILE 115 522 18 Y 1 A PRO 116 ? A PRO 116 523 18 Y 1 A ALA 117 ? A ALA 117 524 18 Y 1 A ILE 118 ? A ILE 118 525 18 Y 1 A SER 119 ? A SER 119 526 18 Y 1 A ALA 120 ? A ALA 120 527 18 Y 1 A LEU 121 ? A LEU 121 528 18 Y 1 A ILE 122 ? A ILE 122 529 18 Y 1 A VAL 123 ? A VAL 123 530 18 Y 1 A ALA 124 ? A ALA 124 531 18 Y 1 A LEU 125 ? A LEU 125 532 18 Y 1 A MET 126 ? A MET 126 533 18 Y 1 A TYR 127 ? A TYR 127 534 18 Y 1 A ARG 128 ? A ARG 128 535 18 Y 1 A LEU 129 ? A LEU 129 536 18 Y 1 A TYR 130 ? A TYR 130 537 18 Y 1 A MET 131 ? A MET 131 538 18 Y 1 A ALA 132 ? A ALA 132 539 18 Y 1 A ASP 133 ? A ASP 133 540 18 Y 1 A ASP 134 ? A ASP 134 541 19 Y 1 A SER 105 ? A SER 105 542 19 Y 1 A ASN 106 ? A ASN 106 543 19 Y 1 A SER 107 ? A SER 107 544 19 Y 1 A SER 108 ? A SER 108 545 19 Y 1 A TRP 109 ? A TRP 109 546 19 Y 1 A TRP 110 ? A TRP 110 547 19 Y 1 A THR 111 ? A THR 111 548 19 Y 1 A ASN 112 ? A ASN 112 549 19 Y 1 A TRP 113 ? A TRP 113 550 19 Y 1 A VAL 114 ? A VAL 114 551 19 Y 1 A ILE 115 ? A ILE 115 552 19 Y 1 A PRO 116 ? A PRO 116 553 19 Y 1 A ALA 117 ? A ALA 117 554 19 Y 1 A ILE 118 ? A ILE 118 555 19 Y 1 A SER 119 ? A SER 119 556 19 Y 1 A ALA 120 ? A ALA 120 557 19 Y 1 A LEU 121 ? A LEU 121 558 19 Y 1 A ILE 122 ? A ILE 122 559 19 Y 1 A VAL 123 ? A VAL 123 560 19 Y 1 A ALA 124 ? A ALA 124 561 19 Y 1 A LEU 125 ? A LEU 125 562 19 Y 1 A MET 126 ? A MET 126 563 19 Y 1 A TYR 127 ? A TYR 127 564 19 Y 1 A ARG 128 ? A ARG 128 565 19 Y 1 A LEU 129 ? A LEU 129 566 19 Y 1 A TYR 130 ? A TYR 130 567 19 Y 1 A MET 131 ? A MET 131 568 19 Y 1 A ALA 132 ? A ALA 132 569 19 Y 1 A ASP 133 ? A ASP 133 570 19 Y 1 A ASP 134 ? A ASP 134 571 20 Y 1 A SER 105 ? A SER 105 572 20 Y 1 A ASN 106 ? A ASN 106 573 20 Y 1 A SER 107 ? A SER 107 574 20 Y 1 A SER 108 ? A SER 108 575 20 Y 1 A TRP 109 ? A TRP 109 576 20 Y 1 A TRP 110 ? A TRP 110 577 20 Y 1 A THR 111 ? A THR 111 578 20 Y 1 A ASN 112 ? A ASN 112 579 20 Y 1 A TRP 113 ? A TRP 113 580 20 Y 1 A VAL 114 ? A VAL 114 581 20 Y 1 A ILE 115 ? A ILE 115 582 20 Y 1 A PRO 116 ? A PRO 116 583 20 Y 1 A ALA 117 ? A ALA 117 584 20 Y 1 A ILE 118 ? A ILE 118 585 20 Y 1 A SER 119 ? A SER 119 586 20 Y 1 A ALA 120 ? A ALA 120 587 20 Y 1 A LEU 121 ? A LEU 121 588 20 Y 1 A ILE 122 ? A ILE 122 589 20 Y 1 A VAL 123 ? A VAL 123 590 20 Y 1 A ALA 124 ? A ALA 124 591 20 Y 1 A LEU 125 ? A LEU 125 592 20 Y 1 A MET 126 ? A MET 126 593 20 Y 1 A TYR 127 ? A TYR 127 594 20 Y 1 A ARG 128 ? A ARG 128 595 20 Y 1 A LEU 129 ? A LEU 129 596 20 Y 1 A TYR 130 ? A TYR 130 597 20 Y 1 A MET 131 ? A MET 131 598 20 Y 1 A ALA 132 ? A ALA 132 599 20 Y 1 A ASP 133 ? A ASP 133 600 20 Y 1 A ASP 134 ? A ASP 134 601 21 Y 1 A SER 105 ? A SER 105 602 21 Y 1 A ASN 106 ? A ASN 106 603 21 Y 1 A SER 107 ? A SER 107 604 21 Y 1 A SER 108 ? A SER 108 605 21 Y 1 A TRP 109 ? A TRP 109 606 21 Y 1 A TRP 110 ? A TRP 110 607 21 Y 1 A THR 111 ? A THR 111 608 21 Y 1 A ASN 112 ? A ASN 112 609 21 Y 1 A TRP 113 ? A TRP 113 610 21 Y 1 A VAL 114 ? A VAL 114 611 21 Y 1 A ILE 115 ? A ILE 115 612 21 Y 1 A PRO 116 ? A PRO 116 613 21 Y 1 A ALA 117 ? A ALA 117 614 21 Y 1 A ILE 118 ? A ILE 118 615 21 Y 1 A SER 119 ? A SER 119 616 21 Y 1 A ALA 120 ? A ALA 120 617 21 Y 1 A LEU 121 ? A LEU 121 618 21 Y 1 A ILE 122 ? A ILE 122 619 21 Y 1 A VAL 123 ? A VAL 123 620 21 Y 1 A ALA 124 ? A ALA 124 621 21 Y 1 A LEU 125 ? A LEU 125 622 21 Y 1 A MET 126 ? A MET 126 623 21 Y 1 A TYR 127 ? A TYR 127 624 21 Y 1 A ARG 128 ? A ARG 128 625 21 Y 1 A LEU 129 ? A LEU 129 626 21 Y 1 A TYR 130 ? A TYR 130 627 21 Y 1 A MET 131 ? A MET 131 628 21 Y 1 A ALA 132 ? A ALA 132 629 21 Y 1 A ASP 133 ? A ASP 133 630 21 Y 1 A ASP 134 ? A ASP 134 631 22 Y 1 A SER 105 ? A SER 105 632 22 Y 1 A ASN 106 ? A ASN 106 633 22 Y 1 A SER 107 ? A SER 107 634 22 Y 1 A SER 108 ? A SER 108 635 22 Y 1 A TRP 109 ? A TRP 109 636 22 Y 1 A TRP 110 ? A TRP 110 637 22 Y 1 A THR 111 ? A THR 111 638 22 Y 1 A ASN 112 ? A ASN 112 639 22 Y 1 A TRP 113 ? A TRP 113 640 22 Y 1 A VAL 114 ? A VAL 114 641 22 Y 1 A ILE 115 ? A ILE 115 642 22 Y 1 A PRO 116 ? A PRO 116 643 22 Y 1 A ALA 117 ? A ALA 117 644 22 Y 1 A ILE 118 ? A ILE 118 645 22 Y 1 A SER 119 ? A SER 119 646 22 Y 1 A ALA 120 ? A ALA 120 647 22 Y 1 A LEU 121 ? A LEU 121 648 22 Y 1 A ILE 122 ? A ILE 122 649 22 Y 1 A VAL 123 ? A VAL 123 650 22 Y 1 A ALA 124 ? A ALA 124 651 22 Y 1 A LEU 125 ? A LEU 125 652 22 Y 1 A MET 126 ? A MET 126 653 22 Y 1 A TYR 127 ? A TYR 127 654 22 Y 1 A ARG 128 ? A ARG 128 655 22 Y 1 A LEU 129 ? A LEU 129 656 22 Y 1 A TYR 130 ? A TYR 130 657 22 Y 1 A MET 131 ? A MET 131 658 22 Y 1 A ALA 132 ? A ALA 132 659 22 Y 1 A ASP 133 ? A ASP 133 660 22 Y 1 A ASP 134 ? A ASP 134 661 23 Y 1 A SER 105 ? A SER 105 662 23 Y 1 A ASN 106 ? A ASN 106 663 23 Y 1 A SER 107 ? A SER 107 664 23 Y 1 A SER 108 ? A SER 108 665 23 Y 1 A TRP 109 ? A TRP 109 666 23 Y 1 A TRP 110 ? A TRP 110 667 23 Y 1 A THR 111 ? A THR 111 668 23 Y 1 A ASN 112 ? A ASN 112 669 23 Y 1 A TRP 113 ? A TRP 113 670 23 Y 1 A VAL 114 ? A VAL 114 671 23 Y 1 A ILE 115 ? A ILE 115 672 23 Y 1 A PRO 116 ? A PRO 116 673 23 Y 1 A ALA 117 ? A ALA 117 674 23 Y 1 A ILE 118 ? A ILE 118 675 23 Y 1 A SER 119 ? A SER 119 676 23 Y 1 A ALA 120 ? A ALA 120 677 23 Y 1 A LEU 121 ? A LEU 121 678 23 Y 1 A ILE 122 ? A ILE 122 679 23 Y 1 A VAL 123 ? A VAL 123 680 23 Y 1 A ALA 124 ? A ALA 124 681 23 Y 1 A LEU 125 ? A LEU 125 682 23 Y 1 A MET 126 ? A MET 126 683 23 Y 1 A TYR 127 ? A TYR 127 684 23 Y 1 A ARG 128 ? A ARG 128 685 23 Y 1 A LEU 129 ? A LEU 129 686 23 Y 1 A TYR 130 ? A TYR 130 687 23 Y 1 A MET 131 ? A MET 131 688 23 Y 1 A ALA 132 ? A ALA 132 689 23 Y 1 A ASP 133 ? A ASP 133 690 23 Y 1 A ASP 134 ? A ASP 134 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING FE' _pdbx_entity_nonpoly.comp_id HEM #