data_2M3A # _entry.id 2M3A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M3A pdb_00002m3a 10.2210/pdb2m3a/pdb RCSB RCSB103154 ? ? BMRB 18951 ? ? WWPDB D_1000103154 ? ? # _pdbx_database_related.db_id 18951 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M3A _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-01-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osborne, M.J.' 1 'Borden, L.B.' 2 # _citation.id primary _citation.title 'Centromere epigenome stability is mediated by structural recognition by the Centromere Licensing Complex' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'De Rop, V.' 1 ? primary 'Dorn, J.F.' 2 ? primary 'Osborne, M.J.' 3 ? primary 'Boisvert, J.' 4 ? primary 'Ryan, J.' 5 ? primary 'Padeganeh, A.' 6 ? primary 'Moevus, C.' 7 ? primary 'Borden, L.B.' 8 ? primary 'Maddox, A.S.' 9 ? primary 'Maddox, P.S.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein KNL-2' _entity.formula_weight 7616.988 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'MYB-like domain, UNP residues 617-678' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPLGSVAKKITWRKQDLDRLKRVIALKKPSASDADWTEVLRLLAKEGVVEPEVVRQIAITRLKWVEP _entity_poly.pdbx_seq_one_letter_code_can GPLGSVAKKITWRKQDLDRLKRVIALKKPSASDADWTEVLRLLAKEGVVEPEVVRQIAITRLKWVEP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 VAL n 1 7 ALA n 1 8 LYS n 1 9 LYS n 1 10 ILE n 1 11 THR n 1 12 TRP n 1 13 ARG n 1 14 LYS n 1 15 GLN n 1 16 ASP n 1 17 LEU n 1 18 ASP n 1 19 ARG n 1 20 LEU n 1 21 LYS n 1 22 ARG n 1 23 VAL n 1 24 ILE n 1 25 ALA n 1 26 LEU n 1 27 LYS n 1 28 LYS n 1 29 PRO n 1 30 SER n 1 31 ALA n 1 32 SER n 1 33 ASP n 1 34 ALA n 1 35 ASP n 1 36 TRP n 1 37 THR n 1 38 GLU n 1 39 VAL n 1 40 LEU n 1 41 ARG n 1 42 LEU n 1 43 LEU n 1 44 ALA n 1 45 LYS n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 VAL n 1 50 GLU n 1 51 PRO n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ARG n 1 56 GLN n 1 57 ILE n 1 58 ALA n 1 59 ILE n 1 60 THR n 1 61 ARG n 1 62 LEU n 1 63 LYS n 1 64 TRP n 1 65 VAL n 1 66 GLU n 1 67 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name nematode _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene knl-2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6P1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O44548_CAEEL _struct_ref.pdbx_db_accession O44548 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VAKKITWRKQDLDRLKRVIALKKPSASDADWTEVLRLLAKEGVVEPEVVRQIAITRLKWVEP _struct_ref.pdbx_align_begin 617 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M3A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O44548 _struct_ref_seq.db_align_beg 617 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 678 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M3A GLY A 1 ? UNP O44548 ? ? 'expression tag' 1 1 1 2M3A PRO A 2 ? UNP O44548 ? ? 'expression tag' 2 2 1 2M3A LEU A 3 ? UNP O44548 ? ? 'expression tag' 3 3 1 2M3A GLY A 4 ? UNP O44548 ? ? 'expression tag' 4 4 1 2M3A SER A 5 ? UNP O44548 ? ? 'expression tag' 5 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY aliphatic' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY aromatic' 1 4 2 '3D 1H-13C NOESY aliphatic' 1 5 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.2 mM [U-99% 13C; U-99% 15N] KNL2, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM DTT, 0.02 % sodium azide, 5 mM Magnesium Sulphate, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.2 mM [U-99% 13C; U-99% 15N] KNL2, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM DTT, 0.02 % sodium azide, 5 mM Magnesium Sulphate, 100% D2O ; 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2M3A _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M3A _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M3A _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'automated structure calculation' CYANA 3,0 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 ? refinement CYANA ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M3A _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M3A _struct.title 'NMR solution structure of a MYB-like DNA binding domain of KNL-2 from C. Elegans' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M3A _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'MYB-like domain, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 13 ? LYS A 28 ? ARG A 13 LYS A 28 1 ? 16 HELX_P HELX_P2 2 SER A 32 ? ALA A 44 ? SER A 32 ALA A 44 1 ? 13 HELX_P HELX_P3 3 LYS A 45 ? GLY A 47 ? LYS A 45 GLY A 47 5 ? 3 HELX_P HELX_P4 4 GLU A 50 ? LEU A 62 ? GLU A 50 LEU A 62 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2M3A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PRO 67 67 67 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-02 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id KNL2-1 0.2 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 DTT-4 2 ? mM ? 1 'sodium azide-5' 0.02 ? % ? 1 'Magnesium Sulphate-6' 5 ? mM ? 1 KNL2-7 0.2 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate-8' 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 DTT-10 2 ? mM ? 2 'sodium azide-11' 0.02 ? % ? 2 'Magnesium Sulphate-12' 5 ? mM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.77 -176.53 2 1 SER A 5 ? ? -175.87 102.80 3 1 ALA A 7 ? ? -171.81 88.43 4 1 LYS A 8 ? ? 59.56 -170.68 5 1 LYS A 28 ? ? 56.13 73.68 6 1 ALA A 31 ? ? 53.29 79.37 7 1 GLU A 50 ? ? -49.49 157.64 8 2 PRO A 2 ? ? -69.78 -171.06 9 2 LEU A 3 ? ? 62.05 97.58 10 2 VAL A 6 ? ? 52.81 82.69 11 2 LYS A 28 ? ? 56.75 73.79 12 2 ALA A 31 ? ? 58.51 80.58 13 2 GLU A 50 ? ? -49.68 157.55 14 3 LEU A 3 ? ? -162.98 100.22 15 3 LYS A 8 ? ? -55.54 175.67 16 3 ALA A 31 ? ? 63.81 80.99 17 3 GLU A 46 ? ? -98.08 30.10 18 3 GLU A 50 ? ? -46.50 159.17 19 4 LEU A 3 ? ? 61.27 99.28 20 4 LYS A 28 ? ? 59.67 73.78 21 4 ALA A 31 ? ? 60.20 77.69 22 4 GLU A 50 ? ? -46.24 158.88 23 5 SER A 5 ? ? -112.61 59.62 24 5 VAL A 6 ? ? 62.30 71.42 25 5 ALA A 7 ? ? 54.13 -173.80 26 5 LYS A 8 ? ? -81.01 -74.89 27 5 LYS A 9 ? ? -143.23 25.45 28 5 LYS A 28 ? ? 55.00 71.21 29 5 ALA A 31 ? ? 58.57 74.59 30 5 GLU A 50 ? ? -47.09 158.79 31 6 PRO A 2 ? ? -69.75 96.36 32 6 VAL A 6 ? ? -67.74 -176.72 33 6 ALA A 7 ? ? -98.00 33.58 34 6 LYS A 9 ? ? 63.12 165.44 35 6 LYS A 28 ? ? 56.21 73.84 36 6 ALA A 31 ? ? 54.74 76.76 37 6 SER A 32 ? ? -179.39 134.90 38 6 GLU A 50 ? ? -46.44 158.99 39 7 ALA A 7 ? ? 60.60 -178.44 40 7 LYS A 8 ? ? 54.77 -174.41 41 7 LYS A 28 ? ? 49.65 74.12 42 7 ALA A 31 ? ? 175.85 87.74 43 7 GLU A 50 ? ? -48.67 158.59 44 8 LYS A 28 ? ? 54.66 73.64 45 8 ALA A 31 ? ? 63.92 72.42 46 8 GLU A 50 ? ? -47.58 158.41 47 9 PRO A 2 ? ? -69.74 -174.65 48 9 SER A 5 ? ? 62.14 176.78 49 9 LYS A 28 ? ? 58.60 73.83 50 9 ALA A 31 ? ? 54.63 80.66 51 9 SER A 32 ? ? -177.38 135.69 52 9 GLU A 50 ? ? -46.62 159.03 53 10 ALA A 7 ? ? -56.80 102.49 54 10 LYS A 28 ? ? 55.43 70.89 55 10 ALA A 31 ? ? 63.70 78.75 56 10 GLU A 50 ? ? -47.88 158.33 #