data_2M4L # _entry.id 2M4L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M4L pdb_00002m4l 10.2210/pdb2m4l/pdb RCSB RCSB103201 ? ? BMRB 19012 ? 10.13018/BMR19012 WWPDB D_1000103201 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-03-27 2 'Structure model' 1 1 2015-02-11 3 'Structure model' 1 2 2015-03-04 4 'Structure model' 1 3 2023-02-01 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' Other 6 6 'Structure model' 'Data collection' 7 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' pdbx_database_status 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M4L _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-02-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19012 BMRB unspecified . JCSG-417790 TargetTrack unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dutta, S.K.' 1 'Serrano, P.' 2 'Geralt, M.' 3 'Wuthrich, K.' 4 'Joint Center for Structural Genomics (JCSG)' 5 # _citation.id primary _citation.title 'NMR structure of the protein BT_0846 from Bacteroides thetaiotaomicron VPI-5482 (NP_809759.1)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dutta, S.K.' 1 ? primary 'Serrano, P.' 2 ? primary 'Geralt, M.' 3 ? primary 'Wuthrich, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'protein BT_0846' _entity.formula_weight 11242.321 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GEDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKIS GTTLKVETGSEAGTYKKQK ; _entity_poly.pdbx_seq_one_letter_code_can ;GEDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKIS GTTLKVETGSEAGTYKKQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier JCSG-417790 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 ASP n 1 4 TRP n 1 5 THR n 1 6 GLU n 1 7 LEU n 1 8 ASN n 1 9 SER n 1 10 ASN n 1 11 ASN n 1 12 ILE n 1 13 ILE n 1 14 GLY n 1 15 TYR n 1 16 TRP n 1 17 SER n 1 18 THR n 1 19 GLY n 1 20 ILE n 1 21 GLU n 1 22 GLY n 1 23 THR n 1 24 HIS n 1 25 LYS n 1 26 LEU n 1 27 LEU n 1 28 SER n 1 29 PHE n 1 30 ASP n 1 31 GLU n 1 32 ASP n 1 33 GLY n 1 34 THR n 1 35 GLY n 1 36 SER n 1 37 PHE n 1 38 GLY n 1 39 ILE n 1 40 TYR n 1 41 SER n 1 42 ASN n 1 43 ALA n 1 44 THR n 1 45 PRO n 1 46 ILE n 1 47 SER n 1 48 PHE n 1 49 GLN n 1 50 MET n 1 51 PHE n 1 52 ASP n 1 53 TYR n 1 54 LYS n 1 55 ILE n 1 56 GLU n 1 57 GLU n 1 58 GLY n 1 59 ARG n 1 60 ILE n 1 61 TYR n 1 62 ILE n 1 63 TYR n 1 64 ASP n 1 65 VAL n 1 66 TYR n 1 67 PRO n 1 68 ASP n 1 69 GLU n 1 70 LYS n 1 71 THR n 1 72 PRO n 1 73 TYR n 1 74 TYR n 1 75 LEU n 1 76 ASP n 1 77 CYS n 1 78 LYS n 1 79 ILE n 1 80 SER n 1 81 GLY n 1 82 THR n 1 83 THR n 1 84 LEU n 1 85 LYS n 1 86 VAL n 1 87 GLU n 1 88 THR n 1 89 GLY n 1 90 SER n 1 91 GLU n 1 92 ALA n 1 93 GLY n 1 94 THR n 1 95 TYR n 1 96 LYS n 1 97 LYS n 1 98 GLN n 1 99 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BT_0846 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain VPI-5482 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides thetaiotaomicron' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226186 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LYS 99 99 99 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR structure of hypothetical protein BT_0846 from Bacteroides thetaiotaomicron VPI-5482 (NP_809759.1)' _exptl.entry_id 2M4L _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M4L _struct.title 'NMR structure of the protein BT_0846 from Bacteroides thetaiotaomicron VPI-5482 (NP_809759.1)' _struct.pdbx_model_details 'closest to the average, model2' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M4L _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text ;human gut microbiome secreted protein, Structural Genomics, Unknown Function, PSI-biology, Joint Center for Structural Genomics, JCSG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8A9G9_BACTN _struct_ref.pdbx_db_accession Q8A9G9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISG TTLKVETGSEAGTYKKQK ; _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M4L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8A9G9 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 99 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2M4L _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8A9G9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 1 -8.49 2 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 2 -9.05 3 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 3 -7.25 4 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 4 4.08 5 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 5 -14.38 6 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 6 -9.92 7 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 7 -2.66 8 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 8 -3.00 9 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 9 -4.21 10 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 10 -11.52 11 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 11 -3.10 12 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 12 -6.09 13 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 13 -10.70 14 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 14 -5.97 15 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 15 -8.36 16 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 16 -6.14 17 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 17 -7.98 18 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 18 0.98 19 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 19 -10.99 20 TYR 66 A . ? TYR 66 A PRO 67 A ? PRO 67 A 20 1.62 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 73 ? LEU A 75 ? TYR A 73 LEU A 75 A 2 ILE A 60 ? TYR A 66 ? ILE A 60 TYR A 66 A 3 THR A 44 ? LYS A 54 ? THR A 44 LYS A 54 A 4 GLY A 35 ? SER A 41 ? GLY A 35 SER A 41 A 5 LYS A 25 ? PHE A 29 ? LYS A 25 PHE A 29 A 6 GLY A 14 ? SER A 17 ? GLY A 14 SER A 17 A 7 TYR A 95 ? LYS A 97 ? TYR A 95 LYS A 97 A 8 THR A 83 ? VAL A 86 ? THR A 83 VAL A 86 A 9 CYS A 77 ? ILE A 79 ? CYS A 77 ILE A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 73 ? O TYR A 73 N ILE A 62 ? N ILE A 62 A 2 3 O TYR A 61 ? O TYR A 61 N LYS A 54 ? N LYS A 54 A 3 4 O PHE A 51 ? O PHE A 51 N GLY A 35 ? N GLY A 35 A 4 5 O GLY A 38 ? O GLY A 38 N LEU A 26 ? N LEU A 26 A 5 6 O PHE A 29 ? O PHE A 29 N GLY A 14 ? N GLY A 14 A 6 7 N SER A 17 ? N SER A 17 O LYS A 96 ? O LYS A 96 A 7 8 O TYR A 95 ? O TYR A 95 N LEU A 84 ? N LEU A 84 A 8 9 O LYS A 85 ? O LYS A 85 N LYS A 78 ? N LYS A 78 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 OE2 A GLU 91 ? ? HH A TYR 95 ? ? 1.56 2 12 OE1 A GLU 91 ? ? HH A TYR 95 ? ? 1.54 3 13 OE2 A GLU 91 ? ? HH A TYR 95 ? ? 1.57 4 17 OE1 A GLU 91 ? ? HH A TYR 95 ? ? 1.49 5 20 OD2 A ASP 52 ? ? HH A TYR 63 ? ? 1.56 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 20 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 15 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TYR _pdbx_validate_rmsd_angle.auth_seq_id_2 15 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TYR _pdbx_validate_rmsd_angle.auth_seq_id_3 15 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.36 _pdbx_validate_rmsd_angle.angle_target_value 121.00 _pdbx_validate_rmsd_angle.angle_deviation -3.64 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 18 ? ? -93.58 -66.17 2 1 ASN A 42 ? ? 44.95 -73.07 3 1 ALA A 43 ? ? -144.16 43.71 4 1 GLU A 57 ? ? -165.73 14.04 5 1 TYR A 63 ? ? -160.60 1.31 6 1 SER A 80 ? ? -141.44 -9.35 7 2 GLU A 2 ? ? -153.95 87.12 8 2 ASN A 42 ? ? 44.48 -75.41 9 2 ALA A 43 ? ? -145.31 47.77 10 2 GLU A 57 ? ? -163.72 14.10 11 2 TYR A 63 ? ? -151.15 -8.94 12 2 SER A 80 ? ? -149.31 43.51 13 2 ALA A 92 ? ? -59.02 105.21 14 3 SER A 9 ? ? -69.31 40.99 15 3 ASN A 10 ? ? -134.26 -59.61 16 3 ASN A 42 ? ? 45.02 -81.54 17 3 ALA A 43 ? ? -141.67 43.54 18 3 GLU A 57 ? ? -164.41 14.35 19 3 TYR A 63 ? ? -156.52 -2.69 20 3 SER A 80 ? ? -128.38 -66.10 21 3 ALA A 92 ? ? -54.96 108.45 22 3 LYS A 97 ? ? 62.43 156.03 23 3 GLN A 98 ? ? -143.11 47.20 24 4 ASN A 42 ? ? 53.06 -78.05 25 4 ALA A 43 ? ? -140.94 21.09 26 4 GLU A 56 ? ? -152.66 45.90 27 4 GLU A 57 ? ? -177.95 14.49 28 4 TYR A 63 ? ? -159.36 -2.62 29 4 SER A 80 ? ? -141.68 -6.98 30 4 ALA A 92 ? ? -46.40 101.61 31 4 LYS A 97 ? ? 68.16 142.42 32 5 GLU A 2 ? ? -69.73 75.54 33 5 ASN A 42 ? ? 44.64 -78.37 34 5 GLU A 57 ? ? -165.76 14.28 35 5 TYR A 63 ? ? -154.74 -1.14 36 5 ALA A 92 ? ? -53.60 108.73 37 5 GLN A 98 ? ? -116.50 56.67 38 6 GLU A 2 ? ? -153.30 75.46 39 6 ASP A 3 ? ? -117.47 65.57 40 6 ASP A 32 ? ? -144.09 32.09 41 6 ASN A 42 ? ? 54.13 -78.47 42 6 ALA A 43 ? ? -143.21 47.97 43 6 GLU A 57 ? ? -164.88 14.66 44 6 ARG A 59 ? ? -121.37 -165.73 45 6 TYR A 63 ? ? -158.31 -5.01 46 7 ASN A 42 ? ? 48.75 -76.38 47 7 GLU A 57 ? ? -170.43 13.73 48 7 TYR A 63 ? ? -160.97 -17.51 49 7 ALA A 92 ? ? -58.14 105.45 50 7 GLN A 98 ? ? -113.76 65.14 51 8 ASP A 3 ? ? -108.52 60.64 52 8 ILE A 12 ? ? -84.45 41.58 53 8 ASN A 42 ? ? 68.63 -64.68 54 8 ALA A 43 ? ? -158.06 49.75 55 8 PHE A 48 ? ? -174.74 118.15 56 8 GLU A 57 ? ? -170.01 14.40 57 8 TYR A 63 ? ? -160.87 6.00 58 8 SER A 80 ? ? -151.45 26.06 59 9 ASP A 3 ? ? -116.54 51.64 60 9 ILE A 20 ? ? -140.26 13.78 61 9 ASN A 42 ? ? 53.36 -78.28 62 9 ALA A 43 ? ? -146.35 34.80 63 9 GLU A 57 ? ? -174.27 14.93 64 9 TYR A 63 ? ? -156.51 -5.24 65 9 ALA A 92 ? ? -56.22 105.84 66 10 ASN A 10 ? ? -130.38 -40.28 67 10 ILE A 13 ? ? -55.74 97.37 68 10 ALA A 43 ? ? -159.74 49.32 69 10 GLU A 57 ? ? -173.33 21.59 70 10 TYR A 63 ? ? -158.25 -5.43 71 10 SER A 80 ? ? -128.64 -61.92 72 10 ALA A 92 ? ? -58.10 103.53 73 10 GLN A 98 ? ? -101.26 55.16 74 11 SER A 9 ? ? -69.08 36.02 75 11 ASN A 10 ? ? -137.78 -58.18 76 11 THR A 18 ? ? -89.84 -77.16 77 11 ASN A 42 ? ? 55.24 -73.05 78 11 ALA A 43 ? ? -143.24 44.24 79 11 GLU A 57 ? ? -165.52 15.10 80 11 TYR A 63 ? ? -160.08 6.96 81 11 SER A 80 ? ? -151.39 48.81 82 11 ALA A 92 ? ? -54.68 105.17 83 12 ASN A 42 ? ? 62.86 -83.58 84 12 ALA A 43 ? ? -150.40 59.98 85 12 GLU A 57 ? ? -174.90 14.98 86 12 TYR A 63 ? ? -157.49 8.57 87 12 ALA A 92 ? ? -56.14 109.24 88 13 ASN A 42 ? ? 46.77 -85.20 89 13 GLU A 57 ? ? -163.14 14.01 90 13 TYR A 63 ? ? -154.06 8.29 91 13 SER A 80 ? ? -152.37 77.53 92 13 LYS A 97 ? ? 61.76 159.28 93 14 ILE A 13 ? ? -57.02 109.58 94 14 THR A 18 ? ? -137.27 -40.03 95 14 ASN A 42 ? ? 43.42 -80.46 96 14 GLU A 57 ? ? -164.25 13.51 97 14 TYR A 63 ? ? -150.25 -1.45 98 14 ALA A 92 ? ? -47.48 109.87 99 15 ASN A 42 ? ? 55.24 -85.95 100 15 GLU A 57 ? ? -166.71 14.13 101 15 TYR A 63 ? ? -158.62 2.59 102 15 THR A 71 ? ? -49.81 150.53 103 16 SER A 9 ? ? -74.04 33.89 104 16 ASN A 10 ? ? -143.76 -32.44 105 16 ILE A 13 ? ? -59.83 104.57 106 16 ASN A 42 ? ? 58.72 -57.74 107 16 ALA A 43 ? ? -154.94 25.30 108 16 GLU A 57 ? ? -164.67 13.73 109 16 ASP A 64 ? ? -169.40 100.46 110 16 SER A 80 ? ? -153.40 46.50 111 16 ALA A 92 ? ? -53.45 109.57 112 16 GLN A 98 ? ? -145.26 20.66 113 17 SER A 9 ? ? -64.07 21.14 114 17 ASN A 10 ? ? -137.83 -52.13 115 17 ASN A 42 ? ? 45.89 -78.91 116 17 GLU A 57 ? ? -169.73 14.27 117 17 TYR A 63 ? ? -156.41 -2.61 118 18 ASN A 42 ? ? 51.73 -65.19 119 18 ALA A 43 ? ? -153.62 36.23 120 18 TYR A 53 ? ? -173.16 135.04 121 18 GLU A 57 ? ? -166.60 14.92 122 18 TYR A 63 ? ? -158.26 -0.19 123 18 SER A 80 ? ? -159.26 45.75 124 18 ALA A 92 ? ? -57.60 104.99 125 19 SER A 9 ? ? -69.27 25.10 126 19 ASN A 10 ? ? -134.63 -53.64 127 19 ASN A 42 ? ? 44.85 -81.46 128 19 ALA A 43 ? ? -143.01 54.25 129 19 GLU A 57 ? ? -164.74 14.70 130 19 TYR A 63 ? ? -160.63 2.34 131 19 THR A 82 ? ? -51.97 7.40 132 19 ALA A 92 ? ? -51.71 108.03 133 20 SER A 9 ? ? -75.95 43.16 134 20 ASN A 10 ? ? -150.21 -50.83 135 20 ASN A 42 ? ? 61.96 -75.73 136 20 ALA A 43 ? ? -147.08 34.57 137 20 GLU A 57 ? ? -174.71 14.56 138 20 TYR A 63 ? ? -158.08 -5.51 139 20 SER A 80 ? ? -147.75 19.58 140 20 ALA A 92 ? ? -46.52 108.81 141 20 GLN A 98 ? ? -143.81 38.27 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 6 GLU A 2 ? ? ASP A 3 ? ? -149.16 2 17 GLU A 21 ? ? GLY A 22 ? ? 149.94 3 18 LYS A 54 ? ? ILE A 55 ? ? 149.60 4 19 SER A 80 ? ? GLY A 81 ? ? -149.14 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 40 ? ? 0.085 'SIDE CHAIN' 2 1 TYR A 53 ? ? 0.066 'SIDE CHAIN' 3 1 ARG A 59 ? ? 0.118 'SIDE CHAIN' 4 3 TYR A 53 ? ? 0.079 'SIDE CHAIN' 5 3 TYR A 63 ? ? 0.076 'SIDE CHAIN' 6 4 TYR A 53 ? ? 0.167 'SIDE CHAIN' 7 4 ARG A 59 ? ? 0.145 'SIDE CHAIN' 8 5 TYR A 66 ? ? 0.074 'SIDE CHAIN' 9 6 ARG A 59 ? ? 0.100 'SIDE CHAIN' 10 6 TYR A 73 ? ? 0.088 'SIDE CHAIN' 11 7 ARG A 59 ? ? 0.089 'SIDE CHAIN' 12 7 TYR A 66 ? ? 0.075 'SIDE CHAIN' 13 8 TYR A 15 ? ? 0.080 'SIDE CHAIN' 14 8 TYR A 66 ? ? 0.089 'SIDE CHAIN' 15 9 TYR A 95 ? ? 0.113 'SIDE CHAIN' 16 10 TYR A 63 ? ? 0.077 'SIDE CHAIN' 17 12 TYR A 95 ? ? 0.102 'SIDE CHAIN' 18 13 TYR A 95 ? ? 0.112 'SIDE CHAIN' 19 14 TYR A 61 ? ? 0.071 'SIDE CHAIN' 20 14 TYR A 95 ? ? 0.066 'SIDE CHAIN' 21 16 TYR A 15 ? ? 0.081 'SIDE CHAIN' 22 16 TYR A 61 ? ? 0.074 'SIDE CHAIN' 23 17 ARG A 59 ? ? 0.115 'SIDE CHAIN' 24 17 TYR A 66 ? ? 0.079 'SIDE CHAIN' 25 17 TYR A 95 ? ? 0.091 'SIDE CHAIN' 26 18 TYR A 53 ? ? 0.073 'SIDE CHAIN' 27 18 ARG A 59 ? ? 0.079 'SIDE CHAIN' 28 19 TYR A 53 ? ? 0.068 'SIDE CHAIN' 29 19 TYR A 95 ? ? 0.072 'SIDE CHAIN' 30 20 TYR A 53 ? ? 0.075 'SIDE CHAIN' 31 20 TYR A 66 ? ? 0.074 'SIDE CHAIN' # _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M4L _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M4L _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '1.2 mM [U-99% 13C; U-99% 15N] protein, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.2 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 'sodium azide-4' 5 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.798 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 4D-HACANH-APSY 1 2 1 5D-HACACONH-APSY 1 3 1 5D-CBCACONH-APSY 1 4 1 '2D 1H-15N HSQC' 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 1 '2D 1H-13C HSQC aromatic' 1 7 1 '3D 1H-15N NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M4L _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1966 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 453 _pdbx_nmr_constraints.NOE_long_range_total_count 803 _pdbx_nmr_constraints.NOE_medium_range_total_count 202 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 508 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2M4L _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 3.1 1 'Bruker Biospin' processing TopSpin 3.1 2 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 3 'Keller and Wuthrich' 'data analysis' CARA ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 5 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' jUNIO ? 6 'Herrmann, Guntert and Wuthrich' 'structure solution' jUNIO ? 7 'Herrmann, Guntert and Wuthrich' 'peak picking' jUNIO ? 8 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPAL ? 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2M4L _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ #