data_2M59 # _entry.id 2M59 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M59 pdb_00002m59 10.2210/pdb2m59/pdb RCSB RCSB103225 ? ? BMRB 19041 ? 10.13018/BMR19041 WWPDB D_1000103225 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-12 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_software 6 3 'Structure model' pdbx_nmr_spectrometer 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 3 'Structure model' '_pdbx_nmr_software.name' 17 3 'Structure model' '_pdbx_nmr_spectrometer.model' 18 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M59 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-02-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19041 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mineev, K.S.' 1 'Arseniev, A.S.' 2 'Shulepko, M.A.' 3 'Lyukmanova, E.N.' 4 # _citation.id primary _citation.title 'Structural and functional characterization of alternative transmembrane domain conformations in VEGF receptor 2 activation.' _citation.journal_abbrev Structure _citation.journal_volume 22 _citation.page_first 1077 _citation.page_last 1089 _citation.year 2014 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 1878-4186 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24980797 _citation.pdbx_database_id_DOI 10.1016/j.str.2014.05.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Manni, S.' 1 ? primary 'Mineev, K.S.' 2 ? primary 'Usmanova, D.' 3 ? primary 'Lyukmanova, E.N.' 4 ? primary 'Shulepko, M.A.' 5 ? primary 'Kirpichnikov, M.P.' 6 ? primary 'Winter, J.' 7 ? primary 'Matkovic, M.' 8 ? primary 'Deupi, X.' 9 ? primary 'Arseniev, A.S.' 10 ? primary 'Ballmer-Hofer, K.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Vascular endothelial growth factor receptor 2' _entity.formula_weight 4131.065 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 759-795' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VEGFR-2, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGG _entity_poly.pdbx_seq_one_letter_code_can EKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGG _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LYS n 1 3 THR n 1 4 ASN n 1 5 LEU n 1 6 GLU n 1 7 ILE n 1 8 ILE n 1 9 ILE n 1 10 LEU n 1 11 VAL n 1 12 GLY n 1 13 THR n 1 14 ALA n 1 15 VAL n 1 16 ILE n 1 17 ALA n 1 18 MET n 1 19 PHE n 1 20 PHE n 1 21 TRP n 1 22 LEU n 1 23 LEU n 1 24 LEU n 1 25 VAL n 1 26 ILE n 1 27 ILE n 1 28 LEU n 1 29 ARG n 1 30 THR n 1 31 VAL n 1 32 LYS n 1 33 ARG n 1 34 ALA n 1 35 ASN n 1 36 GLY n 1 37 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KDR, FLK1, VEGFR2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET20b(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n B 1 1 GLU 1 101 101 GLU GLU B . n B 1 2 LYS 2 102 102 LYS LYS B . n B 1 3 THR 3 103 103 THR THR B . n B 1 4 ASN 4 104 104 ASN ASN B . n B 1 5 LEU 5 105 105 LEU LEU B . n B 1 6 GLU 6 106 106 GLU GLU B . n B 1 7 ILE 7 107 107 ILE ILE B . n B 1 8 ILE 8 108 108 ILE ILE B . n B 1 9 ILE 9 109 109 ILE ILE B . n B 1 10 LEU 10 110 110 LEU LEU B . n B 1 11 VAL 11 111 111 VAL VAL B . n B 1 12 GLY 12 112 112 GLY GLY B . n B 1 13 THR 13 113 113 THR THR B . n B 1 14 ALA 14 114 114 ALA ALA B . n B 1 15 VAL 15 115 115 VAL VAL B . n B 1 16 ILE 16 116 116 ILE ILE B . n B 1 17 ALA 17 117 117 ALA ALA B . n B 1 18 MET 18 118 118 MET MET B . n B 1 19 PHE 19 119 119 PHE PHE B . n B 1 20 PHE 20 120 120 PHE PHE B . n B 1 21 TRP 21 121 121 TRP TRP B . n B 1 22 LEU 22 122 122 LEU LEU B . n B 1 23 LEU 23 123 123 LEU LEU B . n B 1 24 LEU 24 124 124 LEU LEU B . n B 1 25 VAL 25 125 125 VAL VAL B . n B 1 26 ILE 26 126 126 ILE ILE B . n B 1 27 ILE 27 127 127 ILE ILE B . n B 1 28 LEU 28 128 128 LEU LEU B . n B 1 29 ARG 29 129 129 ARG ARG B . n B 1 30 THR 30 130 130 THR THR B . n B 1 31 VAL 31 131 131 VAL VAL B . n B 1 32 LYS 32 132 132 LYS LYS B . n B 1 33 ARG 33 133 133 ARG ARG B . n B 1 34 ALA 34 134 134 ALA ALA B . n B 1 35 ASN 35 135 135 ASN ASN B . n B 1 36 GLY 36 136 136 GLY GLY B . n B 1 37 GLY 37 137 137 GLY GLY B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Spatial structure of dimeric VEGFR2 membrane domain in DPC micelles' _exptl.entry_id 2M59 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M59 _struct.title 'Spatial structure of dimeric VEGFR2 membrane domain in DPC micelles' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M59 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'VEGFR2, receptor tyrosine kinase, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VGFR2_HUMAN _struct_ref.pdbx_db_accession P35968 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGG _struct_ref.pdbx_align_begin 759 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2M59 A 1 ? 37 ? P35968 759 ? 795 ? 1 37 2 1 2M59 B 1 ? 37 ? P35968 759 ? 795 ? 101 137 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1230 ? 1 MORE -16 ? 1 'SSA (A^2)' 6510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 1 ? GLY A 37 ? GLU A 1 GLY A 37 1 ? 37 HELX_P HELX_P2 2 LYS B 2 ? GLY B 37 ? LYS B 102 GLY B 137 1 ? 36 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 8 LYS A 2 ? ? -126.98 -70.13 2 8 LYS B 102 ? ? -126.68 -70.35 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M59 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M59 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents ;0.6 mM VEGFR2tm, 0.6 mM [U-100% 13C; U-100% 15N] VEGFR2tm, 48 mM [U-100% 2H] DPC, 20 mM [U-99% 2H] sodium acetate, 3 mM sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id VEGFR2tm-1 0.6 ? mM ? 1 VEGFR2tm-2 0.6 ? mM '[U-100% 13C; U-100% 15N]' 1 DPC-3 48 ? mM '[U-100% 2H]' 1 'sodium acetate-4' 20 ? mM '[U-99% 2H]' 1 'sodium azide-5' 3 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCA' 1 6 1 '3D HNCO' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '13C,15N - filtered NOESY-HSQC' # _pdbx_nmr_refine.entry_id 2M59 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 2 'Keller and Wuthrich' 'data analysis' CARA 1.8.4 3 'Bruker Biospin' collection TopSpin 3.0 4 'Orekhov, Mayzel' processing qMDD 2.1 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLU N N N N 58 GLU CA C N S 59 GLU C C N N 60 GLU O O N N 61 GLU CB C N N 62 GLU CG C N N 63 GLU CD C N N 64 GLU OE1 O N N 65 GLU OE2 O N N 66 GLU OXT O N N 67 GLU H H N N 68 GLU H2 H N N 69 GLU HA H N N 70 GLU HB2 H N N 71 GLU HB3 H N N 72 GLU HG2 H N N 73 GLU HG3 H N N 74 GLU HE2 H N N 75 GLU HXT H N N 76 GLY N N N N 77 GLY CA C N N 78 GLY C C N N 79 GLY O O N N 80 GLY OXT O N N 81 GLY H H N N 82 GLY H2 H N N 83 GLY HA2 H N N 84 GLY HA3 H N N 85 GLY HXT H N N 86 ILE N N N N 87 ILE CA C N S 88 ILE C C N N 89 ILE O O N N 90 ILE CB C N S 91 ILE CG1 C N N 92 ILE CG2 C N N 93 ILE CD1 C N N 94 ILE OXT O N N 95 ILE H H N N 96 ILE H2 H N N 97 ILE HA H N N 98 ILE HB H N N 99 ILE HG12 H N N 100 ILE HG13 H N N 101 ILE HG21 H N N 102 ILE HG22 H N N 103 ILE HG23 H N N 104 ILE HD11 H N N 105 ILE HD12 H N N 106 ILE HD13 H N N 107 ILE HXT H N N 108 LEU N N N N 109 LEU CA C N S 110 LEU C C N N 111 LEU O O N N 112 LEU CB C N N 113 LEU CG C N N 114 LEU CD1 C N N 115 LEU CD2 C N N 116 LEU OXT O N N 117 LEU H H N N 118 LEU H2 H N N 119 LEU HA H N N 120 LEU HB2 H N N 121 LEU HB3 H N N 122 LEU HG H N N 123 LEU HD11 H N N 124 LEU HD12 H N N 125 LEU HD13 H N N 126 LEU HD21 H N N 127 LEU HD22 H N N 128 LEU HD23 H N N 129 LEU HXT H N N 130 LYS N N N N 131 LYS CA C N S 132 LYS C C N N 133 LYS O O N N 134 LYS CB C N N 135 LYS CG C N N 136 LYS CD C N N 137 LYS CE C N N 138 LYS NZ N N N 139 LYS OXT O N N 140 LYS H H N N 141 LYS H2 H N N 142 LYS HA H N N 143 LYS HB2 H N N 144 LYS HB3 H N N 145 LYS HG2 H N N 146 LYS HG3 H N N 147 LYS HD2 H N N 148 LYS HD3 H N N 149 LYS HE2 H N N 150 LYS HE3 H N N 151 LYS HZ1 H N N 152 LYS HZ2 H N N 153 LYS HZ3 H N N 154 LYS HXT H N N 155 MET N N N N 156 MET CA C N S 157 MET C C N N 158 MET O O N N 159 MET CB C N N 160 MET CG C N N 161 MET SD S N N 162 MET CE C N N 163 MET OXT O N N 164 MET H H N N 165 MET H2 H N N 166 MET HA H N N 167 MET HB2 H N N 168 MET HB3 H N N 169 MET HG2 H N N 170 MET HG3 H N N 171 MET HE1 H N N 172 MET HE2 H N N 173 MET HE3 H N N 174 MET HXT H N N 175 PHE N N N N 176 PHE CA C N S 177 PHE C C N N 178 PHE O O N N 179 PHE CB C N N 180 PHE CG C Y N 181 PHE CD1 C Y N 182 PHE CD2 C Y N 183 PHE CE1 C Y N 184 PHE CE2 C Y N 185 PHE CZ C Y N 186 PHE OXT O N N 187 PHE H H N N 188 PHE H2 H N N 189 PHE HA H N N 190 PHE HB2 H N N 191 PHE HB3 H N N 192 PHE HD1 H N N 193 PHE HD2 H N N 194 PHE HE1 H N N 195 PHE HE2 H N N 196 PHE HZ H N N 197 PHE HXT H N N 198 THR N N N N 199 THR CA C N S 200 THR C C N N 201 THR O O N N 202 THR CB C N R 203 THR OG1 O N N 204 THR CG2 C N N 205 THR OXT O N N 206 THR H H N N 207 THR H2 H N N 208 THR HA H N N 209 THR HB H N N 210 THR HG1 H N N 211 THR HG21 H N N 212 THR HG22 H N N 213 THR HG23 H N N 214 THR HXT H N N 215 TRP N N N N 216 TRP CA C N S 217 TRP C C N N 218 TRP O O N N 219 TRP CB C N N 220 TRP CG C Y N 221 TRP CD1 C Y N 222 TRP CD2 C Y N 223 TRP NE1 N Y N 224 TRP CE2 C Y N 225 TRP CE3 C Y N 226 TRP CZ2 C Y N 227 TRP CZ3 C Y N 228 TRP CH2 C Y N 229 TRP OXT O N N 230 TRP H H N N 231 TRP H2 H N N 232 TRP HA H N N 233 TRP HB2 H N N 234 TRP HB3 H N N 235 TRP HD1 H N N 236 TRP HE1 H N N 237 TRP HE3 H N N 238 TRP HZ2 H N N 239 TRP HZ3 H N N 240 TRP HH2 H N N 241 TRP HXT H N N 242 VAL N N N N 243 VAL CA C N S 244 VAL C C N N 245 VAL O O N N 246 VAL CB C N N 247 VAL CG1 C N N 248 VAL CG2 C N N 249 VAL OXT O N N 250 VAL H H N N 251 VAL H2 H N N 252 VAL HA H N N 253 VAL HB H N N 254 VAL HG11 H N N 255 VAL HG12 H N N 256 VAL HG13 H N N 257 VAL HG21 H N N 258 VAL HG22 H N N 259 VAL HG23 H N N 260 VAL HXT H N N 261 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLU N CA sing N N 55 GLU N H sing N N 56 GLU N H2 sing N N 57 GLU CA C sing N N 58 GLU CA CB sing N N 59 GLU CA HA sing N N 60 GLU C O doub N N 61 GLU C OXT sing N N 62 GLU CB CG sing N N 63 GLU CB HB2 sing N N 64 GLU CB HB3 sing N N 65 GLU CG CD sing N N 66 GLU CG HG2 sing N N 67 GLU CG HG3 sing N N 68 GLU CD OE1 doub N N 69 GLU CD OE2 sing N N 70 GLU OE2 HE2 sing N N 71 GLU OXT HXT sing N N 72 GLY N CA sing N N 73 GLY N H sing N N 74 GLY N H2 sing N N 75 GLY CA C sing N N 76 GLY CA HA2 sing N N 77 GLY CA HA3 sing N N 78 GLY C O doub N N 79 GLY C OXT sing N N 80 GLY OXT HXT sing N N 81 ILE N CA sing N N 82 ILE N H sing N N 83 ILE N H2 sing N N 84 ILE CA C sing N N 85 ILE CA CB sing N N 86 ILE CA HA sing N N 87 ILE C O doub N N 88 ILE C OXT sing N N 89 ILE CB CG1 sing N N 90 ILE CB CG2 sing N N 91 ILE CB HB sing N N 92 ILE CG1 CD1 sing N N 93 ILE CG1 HG12 sing N N 94 ILE CG1 HG13 sing N N 95 ILE CG2 HG21 sing N N 96 ILE CG2 HG22 sing N N 97 ILE CG2 HG23 sing N N 98 ILE CD1 HD11 sing N N 99 ILE CD1 HD12 sing N N 100 ILE CD1 HD13 sing N N 101 ILE OXT HXT sing N N 102 LEU N CA sing N N 103 LEU N H sing N N 104 LEU N H2 sing N N 105 LEU CA C sing N N 106 LEU CA CB sing N N 107 LEU CA HA sing N N 108 LEU C O doub N N 109 LEU C OXT sing N N 110 LEU CB CG sing N N 111 LEU CB HB2 sing N N 112 LEU CB HB3 sing N N 113 LEU CG CD1 sing N N 114 LEU CG CD2 sing N N 115 LEU CG HG sing N N 116 LEU CD1 HD11 sing N N 117 LEU CD1 HD12 sing N N 118 LEU CD1 HD13 sing N N 119 LEU CD2 HD21 sing N N 120 LEU CD2 HD22 sing N N 121 LEU CD2 HD23 sing N N 122 LEU OXT HXT sing N N 123 LYS N CA sing N N 124 LYS N H sing N N 125 LYS N H2 sing N N 126 LYS CA C sing N N 127 LYS CA CB sing N N 128 LYS CA HA sing N N 129 LYS C O doub N N 130 LYS C OXT sing N N 131 LYS CB CG sing N N 132 LYS CB HB2 sing N N 133 LYS CB HB3 sing N N 134 LYS CG CD sing N N 135 LYS CG HG2 sing N N 136 LYS CG HG3 sing N N 137 LYS CD CE sing N N 138 LYS CD HD2 sing N N 139 LYS CD HD3 sing N N 140 LYS CE NZ sing N N 141 LYS CE HE2 sing N N 142 LYS CE HE3 sing N N 143 LYS NZ HZ1 sing N N 144 LYS NZ HZ2 sing N N 145 LYS NZ HZ3 sing N N 146 LYS OXT HXT sing N N 147 MET N CA sing N N 148 MET N H sing N N 149 MET N H2 sing N N 150 MET CA C sing N N 151 MET CA CB sing N N 152 MET CA HA sing N N 153 MET C O doub N N 154 MET C OXT sing N N 155 MET CB CG sing N N 156 MET CB HB2 sing N N 157 MET CB HB3 sing N N 158 MET CG SD sing N N 159 MET CG HG2 sing N N 160 MET CG HG3 sing N N 161 MET SD CE sing N N 162 MET CE HE1 sing N N 163 MET CE HE2 sing N N 164 MET CE HE3 sing N N 165 MET OXT HXT sing N N 166 PHE N CA sing N N 167 PHE N H sing N N 168 PHE N H2 sing N N 169 PHE CA C sing N N 170 PHE CA CB sing N N 171 PHE CA HA sing N N 172 PHE C O doub N N 173 PHE C OXT sing N N 174 PHE CB CG sing N N 175 PHE CB HB2 sing N N 176 PHE CB HB3 sing N N 177 PHE CG CD1 doub Y N 178 PHE CG CD2 sing Y N 179 PHE CD1 CE1 sing Y N 180 PHE CD1 HD1 sing N N 181 PHE CD2 CE2 doub Y N 182 PHE CD2 HD2 sing N N 183 PHE CE1 CZ doub Y N 184 PHE CE1 HE1 sing N N 185 PHE CE2 CZ sing Y N 186 PHE CE2 HE2 sing N N 187 PHE CZ HZ sing N N 188 PHE OXT HXT sing N N 189 THR N CA sing N N 190 THR N H sing N N 191 THR N H2 sing N N 192 THR CA C sing N N 193 THR CA CB sing N N 194 THR CA HA sing N N 195 THR C O doub N N 196 THR C OXT sing N N 197 THR CB OG1 sing N N 198 THR CB CG2 sing N N 199 THR CB HB sing N N 200 THR OG1 HG1 sing N N 201 THR CG2 HG21 sing N N 202 THR CG2 HG22 sing N N 203 THR CG2 HG23 sing N N 204 THR OXT HXT sing N N 205 TRP N CA sing N N 206 TRP N H sing N N 207 TRP N H2 sing N N 208 TRP CA C sing N N 209 TRP CA CB sing N N 210 TRP CA HA sing N N 211 TRP C O doub N N 212 TRP C OXT sing N N 213 TRP CB CG sing N N 214 TRP CB HB2 sing N N 215 TRP CB HB3 sing N N 216 TRP CG CD1 doub Y N 217 TRP CG CD2 sing Y N 218 TRP CD1 NE1 sing Y N 219 TRP CD1 HD1 sing N N 220 TRP CD2 CE2 doub Y N 221 TRP CD2 CE3 sing Y N 222 TRP NE1 CE2 sing Y N 223 TRP NE1 HE1 sing N N 224 TRP CE2 CZ2 sing Y N 225 TRP CE3 CZ3 doub Y N 226 TRP CE3 HE3 sing N N 227 TRP CZ2 CH2 doub Y N 228 TRP CZ2 HZ2 sing N N 229 TRP CZ3 CH2 sing Y N 230 TRP CZ3 HZ3 sing N N 231 TRP CH2 HH2 sing N N 232 TRP OXT HXT sing N N 233 VAL N CA sing N N 234 VAL N H sing N N 235 VAL N H2 sing N N 236 VAL CA C sing N N 237 VAL CA CB sing N N 238 VAL CA HA sing N N 239 VAL C O doub N N 240 VAL C OXT sing N N 241 VAL CB CG1 sing N N 242 VAL CB CG2 sing N N 243 VAL CB HB sing N N 244 VAL CG1 HG11 sing N N 245 VAL CG1 HG12 sing N N 246 VAL CG1 HG13 sing N N 247 VAL CG2 HG21 sing N N 248 VAL CG2 HG22 sing N N 249 VAL CG2 HG23 sing N N 250 VAL OXT HXT sing N N 251 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2M59 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #