data_2M5E # _entry.id 2M5E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M5E pdb_00002m5e 10.2210/pdb2m5e/pdb RCSB RCSB103230 ? ? BMRB 19050 ? 10.13018/BMR19050 WWPDB D_1000103230 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-23 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_site 8 3 'Structure model' chem_comp_atom 9 3 'Structure model' chem_comp_bond 10 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.value' 19 2 'Structure model' '_struct_conn.pdbx_dist_value' 20 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 2 'Structure model' '_struct_site.pdbx_auth_seq_id' 30 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M5E _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-02-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2KXW PDB 'Structure of the C-domain fragment of apo-calmodulin bound to the IQ motif of NaV1.2' unspecified 1EXR PDB 'The 1.0 Angstrom crystal structure of Ca2+-bound calmodulin' unspecified 19050 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fowler, C.A.' 1 'Feldkamp, M.D.' 2 'Yu, L.' 3 'Shea, M.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Calcium triggers reversal of calmodulin on nested anti-parallel sites in the IQ motif of the neuronal voltage-dependent sodium channel NaV1.2. ; 'Biophys. Chem.' 224 1 19 2017 BICIAZ NE 1873-4200 0829 ? 28343066 10.1016/j.bpc.2017.02.006 1 'Structural and Energetic Determinants of Apo Calmodulin Binding to the IQ Motif of the NaV1.2 Voltage-Dependent Sodium Channel' Structure 19 733 747 2011 STRUE6 UK 0969-2126 2005 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hovey, L.' 1 ? primary 'Fowler, C.A.' 2 ? primary 'Mahling, R.' 3 ? primary 'Lin, Z.' 4 ? primary 'Miller, M.S.' 5 ? primary 'Marx, D.C.' 6 ? primary 'Yoder, J.B.' 7 ? primary 'Kim, E.H.' 8 ? primary 'Tefft, K.M.' 9 ? primary 'Waite, B.C.' 10 ? primary 'Feldkamp, M.D.' 11 ? primary 'Yu, L.' 12 ? primary 'Shea, M.A.' 13 ? 1 'Feldkamp, M.D.' 14 ? 1 'Yu, L.' 15 ? 1 'Shea, M.A.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8416.313 1 ? ? 'UNP residues 77-149' ? 2 polymer man 'Sodium channel protein type 2 subunit alpha' 3370.088 1 ? ? 'UNP residues 1901-1927' ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CaM 2 ;Sodium channel protein brain II subunit alpha, Sodium channel protein type II subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.2 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK MKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK A ? 2 'polypeptide(L)' no no KRKQEEVSAIVIQRAYRRYLLKQKVKK KRKQEEVSAIVIQRAYRRYLLKQKVKK B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 GLN n 1 5 ASP n 1 6 SER n 1 7 GLU n 1 8 GLU n 1 9 GLU n 1 10 LEU n 1 11 ILE n 1 12 GLU n 1 13 ALA n 1 14 PHE n 1 15 LYS n 1 16 VAL n 1 17 PHE n 1 18 ASP n 1 19 ARG n 1 20 ASP n 1 21 GLY n 1 22 ASN n 1 23 GLY n 1 24 LEU n 1 25 ILE n 1 26 SER n 1 27 ALA n 1 28 ALA n 1 29 GLU n 1 30 LEU n 1 31 ARG n 1 32 HIS n 1 33 VAL n 1 34 MET n 1 35 THR n 1 36 ASN n 1 37 LEU n 1 38 GLY n 1 39 GLU n 1 40 LYS n 1 41 LEU n 1 42 THR n 1 43 ASP n 1 44 ASP n 1 45 GLU n 1 46 VAL n 1 47 ASP n 1 48 GLU n 1 49 MET n 1 50 ILE n 1 51 ARG n 1 52 GLU n 1 53 ALA n 1 54 ASP n 1 55 ILE n 1 56 ASP n 1 57 GLY n 1 58 ASP n 1 59 GLY n 1 60 HIS n 1 61 ILE n 1 62 ASN n 1 63 TYR n 1 64 GLU n 1 65 GLU n 1 66 PHE n 1 67 VAL n 1 68 ARG n 1 69 MET n 1 70 MET n 1 71 VAL n 1 72 SER n 1 73 LYS n 2 1 LYS n 2 2 ARG n 2 3 LYS n 2 4 GLN n 2 5 GLU n 2 6 GLU n 2 7 VAL n 2 8 SER n 2 9 ALA n 2 10 ILE n 2 11 VAL n 2 12 ILE n 2 13 GLN n 2 14 ARG n 2 15 ALA n 2 16 TYR n 2 17 ARG n 2 18 ARG n 2 19 TYR n 2 20 LEU n 2 21 LEU n 2 22 LYS n 2 23 GLN n 2 24 LYS n 2 25 VAL n 2 26 LYS n 2 27 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? ? 'CAM, GSPATT00015825001' ? d4-2 ? ? ? ? 'Paramecium tetraurelia' 5888 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? PT7-7 ? ? 2 1 sample ? ? ? rat ? 'Scn2a, Scn2a1' ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 76 76 MET MET A . n A 1 2 LYS 2 77 77 LYS LYS A . n A 1 3 GLU 3 78 78 GLU GLU A . n A 1 4 GLN 4 79 79 GLN GLN A . n A 1 5 ASP 5 80 80 ASP ASP A . n A 1 6 SER 6 81 81 SER SER A . n A 1 7 GLU 7 82 82 GLU GLU A . n A 1 8 GLU 8 83 83 GLU GLU A . n A 1 9 GLU 9 84 84 GLU GLU A . n A 1 10 LEU 10 85 85 LEU LEU A . n A 1 11 ILE 11 86 86 ILE ILE A . n A 1 12 GLU 12 87 87 GLU GLU A . n A 1 13 ALA 13 88 88 ALA ALA A . n A 1 14 PHE 14 89 89 PHE PHE A . n A 1 15 LYS 15 90 90 LYS LYS A . n A 1 16 VAL 16 91 91 VAL VAL A . n A 1 17 PHE 17 92 92 PHE PHE A . n A 1 18 ASP 18 93 93 ASP ASP A . n A 1 19 ARG 19 94 94 ARG ARG A . n A 1 20 ASP 20 95 95 ASP ASP A . n A 1 21 GLY 21 96 96 GLY GLY A . n A 1 22 ASN 22 97 97 ASN ASN A . n A 1 23 GLY 23 98 98 GLY GLY A . n A 1 24 LEU 24 99 99 LEU LEU A . n A 1 25 ILE 25 100 100 ILE ILE A . n A 1 26 SER 26 101 101 SER SER A . n A 1 27 ALA 27 102 102 ALA ALA A . n A 1 28 ALA 28 103 103 ALA ALA A . n A 1 29 GLU 29 104 104 GLU GLU A . n A 1 30 LEU 30 105 105 LEU LEU A . n A 1 31 ARG 31 106 106 ARG ARG A . n A 1 32 HIS 32 107 107 HIS HIS A . n A 1 33 VAL 33 108 108 VAL VAL A . n A 1 34 MET 34 109 109 MET MET A . n A 1 35 THR 35 110 110 THR THR A . n A 1 36 ASN 36 111 111 ASN ASN A . n A 1 37 LEU 37 112 112 LEU LEU A . n A 1 38 GLY 38 113 113 GLY GLY A . n A 1 39 GLU 39 114 114 GLU GLU A . n A 1 40 LYS 40 115 115 LYS LYS A . n A 1 41 LEU 41 116 116 LEU LEU A . n A 1 42 THR 42 117 117 THR THR A . n A 1 43 ASP 43 118 118 ASP ASP A . n A 1 44 ASP 44 119 119 ASP ASP A . n A 1 45 GLU 45 120 120 GLU GLU A . n A 1 46 VAL 46 121 121 VAL VAL A . n A 1 47 ASP 47 122 122 ASP ASP A . n A 1 48 GLU 48 123 123 GLU GLU A . n A 1 49 MET 49 124 124 MET MET A . n A 1 50 ILE 50 125 125 ILE ILE A . n A 1 51 ARG 51 126 126 ARG ARG A . n A 1 52 GLU 52 127 127 GLU GLU A . n A 1 53 ALA 53 128 128 ALA ALA A . n A 1 54 ASP 54 129 129 ASP ASP A . n A 1 55 ILE 55 130 130 ILE ILE A . n A 1 56 ASP 56 131 131 ASP ASP A . n A 1 57 GLY 57 132 132 GLY GLY A . n A 1 58 ASP 58 133 133 ASP ASP A . n A 1 59 GLY 59 134 134 GLY GLY A . n A 1 60 HIS 60 135 135 HIS HIS A . n A 1 61 ILE 61 136 136 ILE ILE A . n A 1 62 ASN 62 137 137 ASN ASN A . n A 1 63 TYR 63 138 138 TYR TYR A . n A 1 64 GLU 64 139 139 GLU GLU A . n A 1 65 GLU 65 140 140 GLU GLU A . n A 1 66 PHE 66 141 141 PHE PHE A . n A 1 67 VAL 67 142 142 VAL VAL A . n A 1 68 ARG 68 143 143 ARG ARG A . n A 1 69 MET 69 144 144 MET MET A . n A 1 70 MET 70 145 145 MET MET A . n A 1 71 VAL 71 146 146 VAL VAL A . n A 1 72 SER 72 147 147 SER SER A . n A 1 73 LYS 73 148 148 LYS LYS A . n B 2 1 LYS 1 1901 1901 LYS LYS B . n B 2 2 ARG 2 1902 1902 ARG ARG B . n B 2 3 LYS 3 1903 1903 LYS LYS B . n B 2 4 GLN 4 1904 1904 GLN GLN B . n B 2 5 GLU 5 1905 1905 GLU GLU B . n B 2 6 GLU 6 1906 1906 GLU GLU B . n B 2 7 VAL 7 1907 1907 VAL VAL B . n B 2 8 SER 8 1908 1908 SER SER B . n B 2 9 ALA 9 1909 1909 ALA ALA B . n B 2 10 ILE 10 1910 1910 ILE ILE B . n B 2 11 VAL 11 1911 1911 VAL VAL B . n B 2 12 ILE 12 1912 1912 ILE ILE B . n B 2 13 GLN 13 1913 1913 GLN GLN B . n B 2 14 ARG 14 1914 1914 ARG ARG B . n B 2 15 ALA 15 1915 1915 ALA ALA B . n B 2 16 TYR 16 1916 1916 TYR TYR B . n B 2 17 ARG 17 1917 1917 ARG ARG B . n B 2 18 ARG 18 1918 1918 ARG ARG B . n B 2 19 TYR 19 1919 1919 TYR TYR B . n B 2 20 LEU 20 1920 1920 LEU LEU B . n B 2 21 LEU 21 1921 1921 LEU LEU B . n B 2 22 LYS 22 1922 1922 LYS LYS B . n B 2 23 GLN 23 1923 1923 GLN GLN B . n B 2 24 LYS 24 1924 1924 LYS LYS B . n B 2 25 VAL 25 1925 1925 VAL VAL B . n B 2 26 LYS 26 1926 1926 LYS LYS B . n B 2 27 LYS 27 1927 1927 LYS LYS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 2001 2001 CA CA A . D 3 CA 1 2002 2002 CA CA A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 148 ? O ? A LYS 73 O 2 1 Y 1 B LYS 1927 ? O ? B LYS 27 O 3 2 Y 1 A LYS 148 ? O ? A LYS 73 O 4 2 Y 1 B LYS 1927 ? O ? B LYS 27 O 5 3 Y 1 A LYS 148 ? O ? A LYS 73 O 6 3 Y 1 B LYS 1927 ? O ? B LYS 27 O 7 4 Y 1 A LYS 148 ? O ? A LYS 73 O 8 4 Y 1 B LYS 1927 ? O ? B LYS 27 O 9 5 Y 1 A LYS 148 ? O ? A LYS 73 O 10 5 Y 1 B LYS 1927 ? O ? B LYS 27 O 11 6 Y 1 A LYS 148 ? O ? A LYS 73 O 12 6 Y 1 B LYS 1927 ? O ? B LYS 27 O 13 7 Y 1 A LYS 148 ? O ? A LYS 73 O 14 7 Y 1 B LYS 1927 ? O ? B LYS 27 O 15 8 Y 1 A LYS 148 ? O ? A LYS 73 O 16 8 Y 1 B LYS 1927 ? O ? B LYS 27 O 17 9 Y 1 A LYS 148 ? O ? A LYS 73 O 18 9 Y 1 B LYS 1927 ? O ? B LYS 27 O 19 10 Y 1 A LYS 148 ? O ? A LYS 73 O 20 10 Y 1 B LYS 1927 ? O ? B LYS 27 O 21 11 Y 1 A LYS 148 ? O ? A LYS 73 O 22 11 Y 1 B LYS 1927 ? O ? B LYS 27 O 23 12 Y 1 A LYS 148 ? O ? A LYS 73 O 24 12 Y 1 B LYS 1927 ? O ? B LYS 27 O 25 13 Y 1 A LYS 148 ? O ? A LYS 73 O 26 13 Y 1 B LYS 1927 ? O ? B LYS 27 O 27 14 Y 1 A LYS 148 ? O ? A LYS 73 O 28 14 Y 1 B LYS 1927 ? O ? B LYS 27 O 29 15 Y 1 A LYS 148 ? O ? A LYS 73 O 30 15 Y 1 B LYS 1927 ? O ? B LYS 27 O 31 16 Y 1 A LYS 148 ? O ? A LYS 73 O 32 16 Y 1 B LYS 1927 ? O ? B LYS 27 O 33 17 Y 1 A LYS 148 ? O ? A LYS 73 O 34 17 Y 1 B LYS 1927 ? O ? B LYS 27 O 35 18 Y 1 A LYS 148 ? O ? A LYS 73 O 36 18 Y 1 B LYS 1927 ? O ? B LYS 27 O 37 19 Y 1 A LYS 148 ? O ? A LYS 73 O 38 19 Y 1 B LYS 1927 ? O ? B LYS 27 O 39 20 Y 1 A LYS 148 ? O ? A LYS 73 O 40 20 Y 1 B LYS 1927 ? O ? B LYS 27 O 41 21 Y 1 A LYS 148 ? O ? A LYS 73 O 42 21 Y 1 B LYS 1927 ? O ? B LYS 27 O # _cell.entry_id 2M5E _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M5E _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M5E _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M5E _struct.title 'Structure of the C-domain of Calcium-saturated Calmodulin bound to the IQ motif of NaV1.2' _struct.pdbx_model_details 'minimized average structure, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2M5E _struct_keywords.pdbx_keywords 'CALCIUM-BINDING PROTEIN/METAL TRANSPORT' _struct_keywords.text ;Calcium Binding Protein, NaV1.2, Ion Channel Gating, IQ Motif, Metal Binding, Sodium Channels, Metal Transport, Voltage Dependent, Voltage Gated, Calcium Binding Protein-Metal Transport Complex, Neuronal Peptides, EF-Hand, CALCIUM-BINDING PROTEIN-METAL TRANSPORT complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CALM_PARTE P07463 1 MKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK 77 ? 2 UNP SCN2A_RAT P04775 2 KRKQEEVSAIVIQRAYRRYLLKQKVKK 1901 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2M5E A 1 ? 73 ? P07463 77 ? 149 ? 76 148 2 2 2M5E B 1 ? 27 ? P04775 1901 ? 1927 ? 1901 1927 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 3 ? ASP A 5 ? GLU A 78 ASP A 80 5 ? 3 HELX_P HELX_P2 2 SER A 6 ? ASP A 18 ? SER A 81 ASP A 93 1 ? 13 HELX_P HELX_P3 3 SER A 26 ? GLY A 38 ? SER A 101 GLY A 113 1 ? 13 HELX_P HELX_P4 4 THR A 42 ? ASP A 54 ? THR A 117 ASP A 129 1 ? 13 HELX_P HELX_P5 5 ASN A 62 ? VAL A 71 ? ASN A 137 VAL A 146 1 ? 10 HELX_P HELX_P6 6 GLN B 4 ? LYS B 24 ? GLN B 1904 LYS B 1924 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 18 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 93 A CA 2001 1_555 ? ? ? ? ? ? ? 4.108 ? ? metalc2 metalc ? ? A ASP 18 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 93 A CA 2001 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc3 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 95 A CA 2001 1_555 ? ? ? ? ? ? ? 4.258 ? ? metalc4 metalc ? ? A ASP 20 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 95 A CA 2001 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc5 metalc ? ? A ASN 22 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 97 A CA 2001 1_555 ? ? ? ? ? ? ? 2.509 ? ? metalc6 metalc ? ? A LEU 24 O ? ? ? 1_555 C CA . CA ? ? A LEU 99 A CA 2001 1_555 ? ? ? ? ? ? ? 2.769 ? ? metalc7 metalc ? ? A GLU 29 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 104 A CA 2001 1_555 ? ? ? ? ? ? ? 2.807 ? ? metalc8 metalc ? ? A GLU 29 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 104 A CA 2001 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc9 metalc ? ? A ASP 54 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 129 A CA 2002 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc10 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 131 A CA 2002 1_555 ? ? ? ? ? ? ? 4.578 ? ? metalc11 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 131 A CA 2002 1_555 ? ? ? ? ? ? ? 2.545 ? ? metalc12 metalc ? ? A ASP 58 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 133 A CA 2002 1_555 ? ? ? ? ? ? ? 3.262 ? ? metalc13 metalc ? ? A ASP 58 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 133 A CA 2002 1_555 ? ? ? ? ? ? ? 2.482 ? ? metalc14 metalc ? ? A HIS 60 O ? ? ? 1_555 D CA . CA ? ? A HIS 135 A CA 2002 1_555 ? ? ? ? ? ? ? 2.851 ? ? metalc15 metalc ? ? A GLU 65 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 140 A CA 2002 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc16 metalc ? ? A GLU 65 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 140 A CA 2002 1_555 ? ? ? ? ? ? ? 2.929 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 27.1 ? 2 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 144.5 ? 3 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 117.4 ? 4 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 165.0 ? 5 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 139.4 ? 6 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 23.4 ? 7 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 55.0 ? 8 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 63.2 ? 9 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 124.4 ? 10 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 134.0 ? 11 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 O ? A LEU 24 ? A LEU 99 ? 1_555 55.1 ? 12 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 O ? A LEU 24 ? A LEU 99 ? 1_555 81.5 ? 13 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 O ? A LEU 24 ? A LEU 99 ? 1_555 157.0 ? 14 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 O ? A LEU 24 ? A LEU 99 ? 1_555 134.3 ? 15 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 O ? A LEU 24 ? A LEU 99 ? 1_555 74.6 ? 16 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 116.3 ? 17 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 132.8 ? 18 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 89.1 ? 19 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 67.7 ? 20 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 133.7 ? 21 O ? A LEU 24 ? A LEU 99 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 67.9 ? 22 OD2 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 103.9 ? 23 OD1 ? A ASP 18 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 98.7 ? 24 OD1 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 72.4 ? 25 OD2 ? A ASP 20 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 66.7 ? 26 OD1 ? A ASN 22 ? A ASN 97 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 158.9 ? 27 O ? A LEU 24 ? A LEU 99 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 92.8 ? 28 OE2 ? A GLU 29 ? A GLU 104 ? 1_555 CA ? C CA . ? A CA 2001 ? 1_555 OE1 ? A GLU 29 ? A GLU 104 ? 1_555 50.3 ? 29 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 146.8 ? 30 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 155.2 ? 31 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 14.1 ? 32 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 65.1 ? 33 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 124.8 ? 34 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 132.3 ? 35 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 100.7 ? 36 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 82.5 ? 37 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 90.8 ? 38 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 42.3 ? 39 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 O ? A HIS 60 ? A HIS 135 ? 1_555 55.8 ? 40 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 O ? A HIS 60 ? A HIS 135 ? 1_555 155.7 ? 41 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 O ? A HIS 60 ? A HIS 135 ? 1_555 142.0 ? 42 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 O ? A HIS 60 ? A HIS 135 ? 1_555 66.1 ? 43 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 O ? A HIS 60 ? A HIS 135 ? 1_555 104.6 ? 44 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 87.7 ? 45 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 85.5 ? 46 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 78.1 ? 47 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 149.5 ? 48 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 167.6 ? 49 O ? A HIS 60 ? A HIS 135 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 87.6 ? 50 OD1 ? A ASP 54 ? A ASP 129 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 93.2 ? 51 OD1 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 106.0 ? 52 OD2 ? A ASP 56 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 92.3 ? 53 OD1 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 116.5 ? 54 OD2 ? A ASP 58 ? A ASP 133 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 139.0 ? 55 O ? A HIS 60 ? A HIS 135 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 53.5 ? 56 OE2 ? A GLU 65 ? A GLU 140 ? 1_555 CA ? D CA . ? A CA 2002 ? 1_555 OE1 ? A GLU 65 ? A GLU 140 ? 1_555 48.3 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 2001 ? 5 'BINDING SITE FOR RESIDUE CA A 2001' AC2 Software A CA 2002 ? 5 'BINDING SITE FOR RESIDUE CA A 2002' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 18 ? ASP A 93 . ? 1_555 ? 2 AC1 5 ASP A 20 ? ASP A 95 . ? 1_555 ? 3 AC1 5 ASN A 22 ? ASN A 97 . ? 1_555 ? 4 AC1 5 LEU A 24 ? LEU A 99 . ? 1_555 ? 5 AC1 5 GLU A 29 ? GLU A 104 . ? 1_555 ? 6 AC2 5 ASP A 54 ? ASP A 129 . ? 1_555 ? 7 AC2 5 ASP A 56 ? ASP A 131 . ? 1_555 ? 8 AC2 5 ASP A 58 ? ASP A 133 . ? 1_555 ? 9 AC2 5 HIS A 60 ? HIS A 135 . ? 1_555 ? 10 AC2 5 GLU A 65 ? GLU A 140 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 13 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 81 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 85 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 78 ? ? -124.45 -53.95 2 1 LYS B 1903 ? ? 78.93 -52.21 3 1 LYS B 1926 ? ? 69.20 -66.60 4 2 VAL A 146 ? ? -96.36 39.94 5 2 LYS B 1903 ? ? 60.94 160.91 6 2 VAL B 1925 ? ? 59.31 101.17 7 2 LYS B 1926 ? ? -170.18 34.69 8 3 LYS A 77 ? ? -144.25 -66.32 9 3 VAL A 146 ? ? -98.41 32.21 10 3 ARG B 1902 ? ? 60.02 168.28 11 4 GLU A 78 ? ? 69.08 -66.71 12 4 VAL A 146 ? ? -97.56 39.80 13 4 SER A 147 ? ? -94.32 43.87 14 4 LYS B 1903 ? ? 60.86 105.33 15 4 GLN B 1904 ? ? -151.45 33.33 16 5 LYS A 77 ? ? 62.97 145.21 17 5 GLU A 78 ? ? -170.42 -47.56 18 5 VAL A 146 ? ? -96.97 38.86 19 5 SER A 147 ? ? -66.62 -176.62 20 5 LYS B 1922 ? ? -81.66 -70.17 21 5 LYS B 1924 ? ? 58.09 178.05 22 6 VAL A 146 ? ? -96.04 39.91 23 6 LYS B 1903 ? ? 60.75 163.29 24 6 VAL B 1925 ? ? 63.61 115.47 25 6 LYS B 1926 ? ? -165.15 -42.24 26 7 GLU A 78 ? ? 68.08 -69.12 27 7 ASP A 93 ? ? -65.69 86.86 28 7 VAL A 146 ? ? -98.42 33.18 29 7 GLN B 1904 ? ? 60.25 87.20 30 7 LYS B 1924 ? ? 60.19 110.53 31 8 GLU A 78 ? ? -166.52 -48.51 32 8 ASP A 93 ? ? -69.95 92.92 33 8 ASP A 129 ? ? -69.59 91.50 34 8 VAL A 146 ? ? -98.33 32.47 35 8 LYS B 1926 ? ? -169.80 -46.03 36 9 SER A 147 ? ? -60.07 -171.35 37 9 GLN B 1904 ? ? -161.79 -45.15 38 9 LYS B 1924 ? ? 60.26 173.75 39 9 LYS B 1926 ? ? -174.04 -42.89 40 10 GLN B 1904 ? ? -98.44 33.56 41 10 LYS B 1924 ? ? 64.95 -76.15 42 10 VAL B 1925 ? ? 67.53 110.71 43 10 LYS B 1926 ? ? -148.94 -46.85 44 11 LYS A 77 ? ? 62.92 120.82 45 11 GLU A 78 ? ? -152.58 -51.36 46 11 GLN B 1904 ? ? -117.87 79.43 47 11 LYS B 1924 ? ? -59.89 175.01 48 11 VAL B 1925 ? ? 64.05 138.72 49 12 LYS B 1903 ? ? -154.12 79.97 50 12 GLN B 1904 ? ? -165.26 -61.02 51 13 VAL A 146 ? ? -99.69 30.79 52 13 GLN B 1904 ? ? -169.68 -43.00 53 13 VAL B 1925 ? ? 69.27 -67.62 54 13 LYS B 1926 ? ? -165.29 -55.29 55 14 GLU A 78 ? ? -141.94 -51.61 56 14 GLN B 1904 ? ? -168.08 90.82 57 14 VAL B 1925 ? ? 69.18 -67.28 58 14 LYS B 1926 ? ? -169.04 -67.99 59 15 ASP A 93 ? ? -64.88 93.11 60 15 SER A 101 ? ? -78.23 -168.24 61 15 VAL A 146 ? ? -97.10 37.37 62 15 LYS B 1924 ? ? -59.60 170.58 63 16 GLU A 78 ? ? 71.18 -61.33 64 16 VAL A 146 ? ? -98.08 31.92 65 17 LYS A 77 ? ? -101.42 -166.43 66 17 GLU A 78 ? ? 69.39 -65.40 67 17 ARG B 1902 ? ? 60.10 71.50 68 17 VAL B 1925 ? ? -137.10 -47.00 69 18 GLU A 78 ? ? -146.25 -46.48 70 18 GLN B 1904 ? ? -145.66 45.98 71 18 LYS B 1924 ? ? 58.95 179.87 72 19 LYS A 77 ? ? -160.74 95.16 73 19 PHE A 92 ? ? -60.34 -70.02 74 19 LYS B 1903 ? ? 64.11 -76.36 75 19 LYS B 1924 ? ? -91.68 -66.20 76 21 GLU A 78 ? ? -135.07 -53.06 77 21 VAL A 146 ? ? -99.13 30.07 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M5E _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0039 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0001 _pdbx_nmr_ensemble_rms.entry_id 2M5E _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M5E _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.5 mM [U-100% 13C; U-100% 15N] C-domain of Calmodulin, 1.5 mM IQ motif peptide of NaV1.2, 3.3 mM CALCIUM ION, 10 mM [U-2H] imidazole, 100 mM potassium chloride, 0.01 % sodium azide, 50 uM [U-2H] EDTA, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;1.5 mM [U-100% 13C; U-100% 15N] C-domain of Calmodulin, 1.5 mM IQ motif peptide of NaV1.2, 3.3 mM CALCIUM ION, 10 mM [U-2H] imidazole, 100 mM potassium chloride, 0.01 % sodium azide, 50 uM [U-2H] EDTA, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'C-domain of Calmodulin-1' 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 'IQ motif peptide of NaV1.2-2' 1.5 ? mM ? 1 'CALCIUM ION-3' 3.3 ? mM ? 1 imidazole-4 10 ? mM '[U-2H]' 1 'potassium chloride-5' 100 ? mM ? 1 'sodium azide-6' 0.01 ? % ? 1 EDTA-7 50 ? uM '[U-2H]' 1 'C-domain of Calmodulin-8' 1.5 ? mM '[U-100% 13C; U-100% 15N]' 2 'IQ motif peptide of NaV1.2-9' 1.5 ? mM ? 2 'CALCIUM ION-10' 3.3 ? mM ? 2 imidazole-11 10 ? mM '[U-2H]' 2 'potassium chloride-12' 100 ? mM ? 2 'sodium azide-13' 0.01 ? % ? 2 EDTA-14 50 ? uM '[U-2H]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HMQC' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(COCA)CB' 1 7 1 '3D HNCO' 1 8 1 '3D HN(CA)CO' 1 9 1 '3D C(CO)NH' 1 10 1 '3D H(CCO)NH' 1 11 1 '3D 1H-15N NOESY' 1 12 2 '3D 1H-13C NOESY' 1 13 2 '3D HCCH-TOCSY' 1 14 1 '2D 1H-15N HSQC' 1 15 2 '2D 1H-13C HMQC' 1 16 2 '3D 1H-13C edited, 12C filtered NOESY' 1 17 1 '2D 1H-1H doubly 12C,14N filtered NOESY' 1 18 1 '2D 1H-1H 12C,14N filtered TOCSY' 1 19 2 '2D 1H-1H 12C filtered NOESY' 1 20 2 '2D 1H-1H 12C,14N filtered TOCSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M5E _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2721 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 492 _pdbx_nmr_constraints.NOE_long_range_total_count 399 _pdbx_nmr_constraints.NOE_medium_range_total_count 415 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 393 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2M5E _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'RESIDUES 1901-1903 AND 1925-1927 IN THE PEPTIDE ARE COMPLETELY UNRESTRAINED' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 Goddard 'chemical shift assignment' Sparky 3.115 2 Goddard 'peak picking' Sparky 3.115 3 Goddard 'data analysis' Sparky 3.115 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 6 CCPN 'peak picking' Analysis 2.1.5 7 CCPN 'chemical shift assignment' Analysis 2.1.5 8 CCPN 'data analysis' Analysis 2.1.5 9 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.3 10 ;Linge, O'Donoghue and Nilges ; 'data analysis' ARIA 2.3 11 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNSSOLVE 1.21 12 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE 1.21 13 'Brunger, Adams, Clore, Gros, Nilges and Read' 'data analysis' CNSSOLVE 1.21 14 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.23 15 'Schwieters, Kuszewski, Tjandra and Clore' 'data analysis' 'X-PLOR NIH' 2.23 16 'Laskowski and MacArthur' 'data analysis' ProcheckNMR 3.5.4 17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TYR N N N N 288 TYR CA C N S 289 TYR C C N N 290 TYR O O N N 291 TYR CB C N N 292 TYR CG C Y N 293 TYR CD1 C Y N 294 TYR CD2 C Y N 295 TYR CE1 C Y N 296 TYR CE2 C Y N 297 TYR CZ C Y N 298 TYR OH O N N 299 TYR OXT O N N 300 TYR H H N N 301 TYR H2 H N N 302 TYR HA H N N 303 TYR HB2 H N N 304 TYR HB3 H N N 305 TYR HD1 H N N 306 TYR HD2 H N N 307 TYR HE1 H N N 308 TYR HE2 H N N 309 TYR HH H N N 310 TYR HXT H N N 311 VAL N N N N 312 VAL CA C N S 313 VAL C C N N 314 VAL O O N N 315 VAL CB C N N 316 VAL CG1 C N N 317 VAL CG2 C N N 318 VAL OXT O N N 319 VAL H H N N 320 VAL H2 H N N 321 VAL HA H N N 322 VAL HB H N N 323 VAL HG11 H N N 324 VAL HG12 H N N 325 VAL HG13 H N N 326 VAL HG21 H N N 327 VAL HG22 H N N 328 VAL HG23 H N N 329 VAL HXT H N N 330 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TYR N CA sing N N 274 TYR N H sing N N 275 TYR N H2 sing N N 276 TYR CA C sing N N 277 TYR CA CB sing N N 278 TYR CA HA sing N N 279 TYR C O doub N N 280 TYR C OXT sing N N 281 TYR CB CG sing N N 282 TYR CB HB2 sing N N 283 TYR CB HB3 sing N N 284 TYR CG CD1 doub Y N 285 TYR CG CD2 sing Y N 286 TYR CD1 CE1 sing Y N 287 TYR CD1 HD1 sing N N 288 TYR CD2 CE2 doub Y N 289 TYR CD2 HD2 sing N N 290 TYR CE1 CZ doub Y N 291 TYR CE1 HE1 sing N N 292 TYR CE2 CZ sing Y N 293 TYR CE2 HE2 sing N N 294 TYR CZ OH sing N N 295 TYR OH HH sing N N 296 TYR OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker 'AVANCE II' 1 'Bruker Avance II' 800 Bruker 'AVANCE II' 2 'Bruker Avance II' # _atom_sites.entry_id 2M5E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_