data_2M5S # _entry.id 2M5S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M5S pdb_00002m5s 10.2210/pdb2m5s/pdb RCSB RCSB103244 ? ? BMRB 18566 ? 10.13018/BMR18566 WWPDB D_1000103244 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-05 2 'Structure model' 1 1 2014-06-18 3 'Structure model' 1 2 2014-07-02 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M5S _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-03-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 3IYI PDB ;cryo-EM model of P22's coat protein in the procapsid ; unspecified 3IYH PDB ;cryo-EM model of P22's coat protein in the expanded head ; unspecified 2XYY PDB ;cryo-EM model of P22's coat protein in the procapsid ; unspecified 2XYZ PDB ;cryo-EM model of P22's coat protein in the virion ; unspecified 18566 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rizzo, A.A.' 1 'Suhanovsky, M.M.' 2 'Baker, M.L.' 3 'Fraser, L.C.R.' 4 'Jones, L.M.' 5 'Rempel, D.L.' 6 'Gross, M.L.' 7 'Chiu, W.' 8 'Alexandrescu, A.T.' 9 'Teschke, C.M.' 10 # _citation.id primary _citation.title ;Multiple Functional Roles of the Accessory I-Domain of Bacteriophage P22 Coat Protein Revealed by NMR Structure and CryoEM Modeling. ; _citation.journal_abbrev Structure _citation.journal_volume 22 _citation.page_first 830 _citation.page_last 841 _citation.year 2014 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24836025 _citation.pdbx_database_id_DOI 10.1016/j.str.2014.04.003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rizzo, A.A.' 1 ? primary 'Suhanovsky, M.M.' 2 ? primary 'Baker, M.L.' 3 ? primary 'Fraser, L.C.' 4 ? primary 'Jones, L.M.' 5 ? primary 'Rempel, D.L.' 6 ? primary 'Gross, M.L.' 7 ? primary 'Chiu, W.' 8 ? primary 'Alexandrescu, A.T.' 9 ? primary 'Teschke, C.M.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Coat protein' _entity.formula_weight 13865.555 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ;This domain has previously been called the 'extra-density domain' and 'telokin-like domain' in the literature based on cryo-EM models ; _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein gp5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATF SVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNV ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATF SVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 GLY n 1 8 SER n 1 9 THR n 1 10 ALA n 1 11 THR n 1 12 GLY n 1 13 ILE n 1 14 THR n 1 15 VAL n 1 16 SER n 1 17 GLY n 1 18 ALA n 1 19 GLN n 1 20 SER n 1 21 PHE n 1 22 LYS n 1 23 PRO n 1 24 VAL n 1 25 ALA n 1 26 TRP n 1 27 GLN n 1 28 LEU n 1 29 ASP n 1 30 ASN n 1 31 ASP n 1 32 GLY n 1 33 ASN n 1 34 LYS n 1 35 VAL n 1 36 ASN n 1 37 VAL n 1 38 ASP n 1 39 ASN n 1 40 ARG n 1 41 PHE n 1 42 ALA n 1 43 THR n 1 44 VAL n 1 45 THR n 1 46 LEU n 1 47 SER n 1 48 ALA n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 MET n 1 53 LYS n 1 54 ARG n 1 55 GLY n 1 56 ASP n 1 57 LYS n 1 58 ILE n 1 59 SER n 1 60 PHE n 1 61 ALA n 1 62 GLY n 1 63 VAL n 1 64 LYS n 1 65 PHE n 1 66 LEU n 1 67 GLY n 1 68 GLN n 1 69 MET n 1 70 ALA n 1 71 LYS n 1 72 ASN n 1 73 VAL n 1 74 LEU n 1 75 ALA n 1 76 GLN n 1 77 ASP n 1 78 ALA n 1 79 THR n 1 80 PHE n 1 81 SER n 1 82 VAL n 1 83 VAL n 1 84 ARG n 1 85 VAL n 1 86 VAL n 1 87 ASP n 1 88 GLY n 1 89 THR n 1 90 HIS n 1 91 VAL n 1 92 GLU n 1 93 ILE n 1 94 THR n 1 95 PRO n 1 96 LYS n 1 97 PRO n 1 98 VAL n 1 99 ALA n 1 100 LEU n 1 101 ASP n 1 102 ASP n 1 103 VAL n 1 104 SER n 1 105 LEU n 1 106 SER n 1 107 PRO n 1 108 GLU n 1 109 GLN n 1 110 ARG n 1 111 ALA n 1 112 TYR n 1 113 ALA n 1 114 ASN n 1 115 VAL n 1 116 ASN n 1 117 THR n 1 118 SER n 1 119 LEU n 1 120 ALA n 1 121 ASP n 1 122 ALA n 1 123 MET n 1 124 ALA n 1 125 VAL n 1 126 ASN n 1 127 ILE n 1 128 LEU n 1 129 ASN n 1 130 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene '5, gp5 coat protein' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage P22' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10754 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET30b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 216 ? ? ? A . n A 1 2 HIS 2 217 ? ? ? A . n A 1 3 HIS 3 218 ? ? ? A . n A 1 4 HIS 4 219 ? ? ? A . n A 1 5 HIS 5 220 ? ? ? A . n A 1 6 HIS 6 221 ? ? ? A . n A 1 7 GLY 7 222 222 GLY GLY A . n A 1 8 SER 8 223 223 SER SER A . n A 1 9 THR 9 224 224 THR THR A . n A 1 10 ALA 10 225 225 ALA ALA A . n A 1 11 THR 11 226 226 THR THR A . n A 1 12 GLY 12 227 227 GLY GLY A . n A 1 13 ILE 13 228 228 ILE ILE A . n A 1 14 THR 14 229 229 THR THR A . n A 1 15 VAL 15 230 230 VAL VAL A . n A 1 16 SER 16 231 231 SER SER A . n A 1 17 GLY 17 232 232 GLY GLY A . n A 1 18 ALA 18 233 233 ALA ALA A . n A 1 19 GLN 19 234 234 GLN GLN A . n A 1 20 SER 20 235 235 SER SER A . n A 1 21 PHE 21 236 236 PHE PHE A . n A 1 22 LYS 22 237 237 LYS LYS A . n A 1 23 PRO 23 238 238 PRO PRO A . n A 1 24 VAL 24 239 239 VAL VAL A . n A 1 25 ALA 25 240 240 ALA ALA A . n A 1 26 TRP 26 241 241 TRP TRP A . n A 1 27 GLN 27 242 242 GLN GLN A . n A 1 28 LEU 28 243 243 LEU LEU A . n A 1 29 ASP 29 244 244 ASP ASP A . n A 1 30 ASN 30 245 245 ASN ASN A . n A 1 31 ASP 31 246 246 ASP ASP A . n A 1 32 GLY 32 247 247 GLY GLY A . n A 1 33 ASN 33 248 248 ASN ASN A . n A 1 34 LYS 34 249 249 LYS LYS A . n A 1 35 VAL 35 250 250 VAL VAL A . n A 1 36 ASN 36 251 251 ASN ASN A . n A 1 37 VAL 37 252 252 VAL VAL A . n A 1 38 ASP 38 253 253 ASP ASP A . n A 1 39 ASN 39 254 254 ASN ASN A . n A 1 40 ARG 40 255 255 ARG ARG A . n A 1 41 PHE 41 256 256 PHE PHE A . n A 1 42 ALA 42 257 257 ALA ALA A . n A 1 43 THR 43 258 258 THR THR A . n A 1 44 VAL 44 259 259 VAL VAL A . n A 1 45 THR 45 260 260 THR THR A . n A 1 46 LEU 46 261 261 LEU LEU A . n A 1 47 SER 47 262 262 SER SER A . n A 1 48 ALA 48 263 263 ALA ALA A . n A 1 49 THR 49 264 264 THR THR A . n A 1 50 THR 50 265 265 THR THR A . n A 1 51 GLY 51 266 266 GLY GLY A . n A 1 52 MET 52 267 267 MET MET A . n A 1 53 LYS 53 268 268 LYS LYS A . n A 1 54 ARG 54 269 269 ARG ARG A . n A 1 55 GLY 55 270 270 GLY GLY A . n A 1 56 ASP 56 271 271 ASP ASP A . n A 1 57 LYS 57 272 272 LYS LYS A . n A 1 58 ILE 58 273 273 ILE ILE A . n A 1 59 SER 59 274 274 SER SER A . n A 1 60 PHE 60 275 275 PHE PHE A . n A 1 61 ALA 61 276 276 ALA ALA A . n A 1 62 GLY 62 277 277 GLY GLY A . n A 1 63 VAL 63 278 278 VAL VAL A . n A 1 64 LYS 64 279 279 LYS LYS A . n A 1 65 PHE 65 280 280 PHE PHE A . n A 1 66 LEU 66 281 281 LEU LEU A . n A 1 67 GLY 67 282 282 GLY GLY A . n A 1 68 GLN 68 283 283 GLN GLN A . n A 1 69 MET 69 284 284 MET MET A . n A 1 70 ALA 70 285 285 ALA ALA A . n A 1 71 LYS 71 286 286 LYS LYS A . n A 1 72 ASN 72 287 287 ASN ASN A . n A 1 73 VAL 73 288 288 VAL VAL A . n A 1 74 LEU 74 289 289 LEU LEU A . n A 1 75 ALA 75 290 290 ALA ALA A . n A 1 76 GLN 76 291 291 GLN GLN A . n A 1 77 ASP 77 292 292 ASP ASP A . n A 1 78 ALA 78 293 293 ALA ALA A . n A 1 79 THR 79 294 294 THR THR A . n A 1 80 PHE 80 295 295 PHE PHE A . n A 1 81 SER 81 296 296 SER SER A . n A 1 82 VAL 82 297 297 VAL VAL A . n A 1 83 VAL 83 298 298 VAL VAL A . n A 1 84 ARG 84 299 299 ARG ARG A . n A 1 85 VAL 85 300 300 VAL VAL A . n A 1 86 VAL 86 301 301 VAL VAL A . n A 1 87 ASP 87 302 302 ASP ASP A . n A 1 88 GLY 88 303 303 GLY GLY A . n A 1 89 THR 89 304 304 THR THR A . n A 1 90 HIS 90 305 305 HIS HIS A . n A 1 91 VAL 91 306 306 VAL VAL A . n A 1 92 GLU 92 307 307 GLU GLU A . n A 1 93 ILE 93 308 308 ILE ILE A . n A 1 94 THR 94 309 309 THR THR A . n A 1 95 PRO 95 310 310 PRO PRO A . n A 1 96 LYS 96 311 311 LYS LYS A . n A 1 97 PRO 97 312 312 PRO PRO A . n A 1 98 VAL 98 313 313 VAL VAL A . n A 1 99 ALA 99 314 314 ALA ALA A . n A 1 100 LEU 100 315 315 LEU LEU A . n A 1 101 ASP 101 316 316 ASP ASP A . n A 1 102 ASP 102 317 317 ASP ASP A . n A 1 103 VAL 103 318 318 VAL VAL A . n A 1 104 SER 104 319 319 SER SER A . n A 1 105 LEU 105 320 320 LEU LEU A . n A 1 106 SER 106 321 321 SER SER A . n A 1 107 PRO 107 322 322 PRO PRO A . n A 1 108 GLU 108 323 323 GLU GLU A . n A 1 109 GLN 109 324 324 GLN GLN A . n A 1 110 ARG 110 325 325 ARG ARG A . n A 1 111 ALA 111 326 326 ALA ALA A . n A 1 112 TYR 112 327 327 TYR TYR A . n A 1 113 ALA 113 328 328 ALA ALA A . n A 1 114 ASN 114 329 329 ASN ASN A . n A 1 115 VAL 115 330 330 VAL VAL A . n A 1 116 ASN 116 331 331 ASN ASN A . n A 1 117 THR 117 332 332 THR THR A . n A 1 118 SER 118 333 333 SER SER A . n A 1 119 LEU 119 334 334 LEU LEU A . n A 1 120 ALA 120 335 335 ALA ALA A . n A 1 121 ASP 121 336 336 ASP ASP A . n A 1 122 ALA 122 337 337 ALA ALA A . n A 1 123 MET 123 338 338 MET MET A . n A 1 124 ALA 124 339 339 ALA ALA A . n A 1 125 VAL 125 340 340 VAL VAL A . n A 1 126 ASN 126 341 341 ASN ASN A . n A 1 127 ILE 127 342 342 ILE ILE A . n A 1 128 LEU 128 343 343 LEU LEU A . n A 1 129 ASN 129 344 344 ASN ASN A . n A 1 130 VAL 130 345 345 VAL VAL A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;NMR structure of amino acids 223-345 from P22's coat protein ; _exptl.entry_id 2M5S _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M5S _struct.title ;High-resolution NMR structure and cryo-EM imaging support multiple functional roles for the accessory I-domain of phage P22 coat protein ; _struct.pdbx_model_details 'closest to the aveerage, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M5S _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'telokin-like domain, extra-density domain, D-loop, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VG05_BPP22 _struct_ref.pdbx_db_accession P26747 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVD GTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNV ; _struct_ref.pdbx_align_begin 223 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M5S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26747 _struct_ref_seq.db_align_beg 223 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 223 _struct_ref_seq.pdbx_auth_seq_align_end 345 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M5S HIS A 1 ? UNP P26747 ? ? 'expression tag' 216 1 1 2M5S HIS A 2 ? UNP P26747 ? ? 'expression tag' 217 2 1 2M5S HIS A 3 ? UNP P26747 ? ? 'expression tag' 218 3 1 2M5S HIS A 4 ? UNP P26747 ? ? 'expression tag' 219 4 1 2M5S HIS A 5 ? UNP P26747 ? ? 'expression tag' 220 5 1 2M5S HIS A 6 ? UNP P26747 ? ? 'expression tag' 221 6 1 2M5S GLY A 7 ? UNP P26747 ? ? 'expression tag' 222 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id HA _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 107 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 112 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 322 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 327 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 1 -1.60 2 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 2 -0.59 3 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 3 1.02 4 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 4 -0.51 5 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 5 -2.51 6 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 6 -2.01 7 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 7 -0.46 8 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 8 2.36 9 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 9 -1.38 10 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 10 -4.90 11 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 11 -4.01 12 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 12 0.01 13 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 13 1.24 14 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 14 -2.90 15 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 15 0.06 16 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 16 -4.63 17 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 17 -2.03 18 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 18 -0.29 19 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 19 -1.83 20 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 20 -2.73 21 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 21 -3.11 22 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 22 -2.40 23 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 23 -1.40 24 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 24 -1.56 25 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 25 -1.98 26 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 26 -1.86 27 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 27 -3.08 28 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 28 -3.26 29 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 29 -1.60 30 THR 94 A . ? THR 309 A PRO 95 A ? PRO 310 A 30 -3.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details BS1 ? 7 ? BS2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense BS1 1 2 ? anti-parallel BS1 2 3 ? anti-parallel BS1 3 4 ? anti-parallel BS1 4 5 ? anti-parallel BS1 5 6 ? anti-parallel BS1 6 7 ? anti-parallel BS2 1 2 ? parallel BS2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id BS1 1 ARG A 40 ? ALA A 48 ? ARG A 255 ALA A 263 BS1 2 THR A 89 ? THR A 94 ? THR A 304 THR A 309 BS1 3 ASP A 77 ? ASP A 87 ? ASP A 292 ASP A 302 BS1 4 ARG A 54 ? ALA A 61 ? ARG A 269 ALA A 276 BS1 5 ALA A 120 ? ILE A 127 ? ALA A 335 ILE A 342 BS1 6 ILE A 13 ? ALA A 18 ? ILE A 228 ALA A 233 BS1 7 ARG A 40 ? ALA A 48 ? ARG A 255 ALA A 263 BS2 1 VAL A 98 ? ASP A 101 ? VAL A 313 ASP A 316 BS2 2 ASN A 114 ? THR A 117 ? ASN A 329 THR A 332 BS2 3 VAL A 63 ? PHE A 65 ? VAL A 278 PHE A 280 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id BS1 1 2 O VAL A 44 ? O VAL A 259 N VAL A 91 ? N VAL A 306 BS1 3 4 O PHE A 80 ? O PHE A 295 N ILE A 58 ? N ILE A 273 BS1 4 5 O SER A 59 ? O SER A 274 N ASN A 126 ? N ASN A 341 BS1 5 6 O VAL A 125 ? O VAL A 340 N ILE A 13 ? N ILE A 228 BS1 6 7 O THR A 14 ? O THR A 229 N SER A 47 ? N SER A 262 BS2 1 2 O VAL A 98 ? O VAL A 313 N VAL A 115 ? N VAL A 330 BS2 2 3 H ASN A 116 ? H ASN A 331 O LYS A 64 ? O LYS A 279 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 17 HZ3 A LYS 268 ? ? OD2 A ASP 271 ? ? 1.59 2 22 HZ3 A LYS 237 ? ? OD2 A ASP 317 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 226 ? ? -108.39 -62.61 2 1 LYS A 286 ? ? -131.05 -52.06 3 1 LEU A 289 ? ? -97.25 55.51 4 1 THR A 304 ? ? -147.92 19.49 5 1 HIS A 305 ? ? -169.98 113.15 6 1 ALA A 337 ? ? -176.94 30.33 7 2 SER A 231 ? ? -105.33 73.51 8 2 LEU A 243 ? ? 68.14 -174.72 9 2 ASP A 244 ? ? -96.47 -157.93 10 2 ARG A 255 ? ? -90.71 -64.29 11 2 MET A 284 ? ? -98.42 31.62 12 2 LEU A 289 ? ? -84.39 46.10 13 2 HIS A 305 ? ? -164.14 119.64 14 2 ALA A 337 ? ? -178.23 29.06 15 3 ALA A 225 ? ? 47.23 70.61 16 3 THR A 226 ? ? -106.36 -79.00 17 3 SER A 231 ? ? -107.11 60.04 18 3 ASP A 246 ? ? -175.34 -44.13 19 3 LYS A 286 ? ? -148.94 -41.60 20 3 THR A 304 ? ? -150.27 19.49 21 3 HIS A 305 ? ? -169.03 115.84 22 3 ASN A 329 ? ? -135.13 -33.36 23 4 ALA A 225 ? ? 57.36 75.46 24 4 THR A 226 ? ? -73.16 40.32 25 4 SER A 231 ? ? -105.52 76.77 26 4 TRP A 241 ? ? 67.09 -174.03 27 4 GLN A 242 ? ? 68.47 122.85 28 4 ASN A 251 ? ? 63.49 81.33 29 4 LYS A 286 ? ? -166.21 54.19 30 4 LEU A 289 ? ? -87.43 42.72 31 4 THR A 304 ? ? -151.90 20.57 32 4 HIS A 305 ? ? -171.43 114.94 33 5 SER A 231 ? ? -102.20 72.52 34 5 ASN A 248 ? ? -100.61 73.18 35 5 ASN A 251 ? ? 69.96 126.56 36 5 MET A 284 ? ? 75.93 -45.84 37 5 ALA A 293 ? ? -64.21 86.09 38 5 THR A 304 ? ? -143.00 16.09 39 5 HIS A 305 ? ? -171.54 116.28 40 5 ALA A 337 ? ? -142.85 40.99 41 6 ASP A 244 ? ? -107.93 -92.52 42 6 ALA A 293 ? ? -52.91 104.08 43 6 ALA A 337 ? ? -153.09 32.23 44 7 THR A 226 ? ? -66.81 -77.24 45 7 SER A 231 ? ? -101.93 47.70 46 7 TRP A 241 ? ? 71.74 -53.21 47 7 ASP A 246 ? ? -124.47 -59.87 48 7 ASN A 251 ? ? 62.54 -154.70 49 7 LYS A 286 ? ? -151.85 24.02 50 7 ARG A 299 ? ? -176.85 139.33 51 7 THR A 304 ? ? -143.51 16.42 52 7 HIS A 305 ? ? -165.47 118.25 53 7 ALA A 337 ? ? -143.00 57.85 54 8 SER A 231 ? ? -116.73 78.81 55 8 TRP A 241 ? ? 72.51 155.62 56 8 ASP A 244 ? ? -119.16 -151.29 57 8 LEU A 289 ? ? -91.56 53.93 58 8 ARG A 299 ? ? -173.47 138.41 59 8 THR A 304 ? ? -149.92 22.30 60 8 HIS A 305 ? ? -174.08 115.59 61 9 LEU A 243 ? ? -141.80 35.51 62 9 ASP A 244 ? ? 59.90 -108.67 63 9 LEU A 281 ? ? -81.65 44.35 64 9 LYS A 286 ? ? -155.23 -41.39 65 9 ALA A 293 ? ? -59.78 106.76 66 9 HIS A 305 ? ? -162.74 116.60 67 9 ASN A 329 ? ? -137.18 -35.72 68 10 SER A 231 ? ? -116.82 78.90 69 10 ALA A 240 ? ? -100.32 -169.34 70 10 TRP A 241 ? ? 72.87 127.09 71 10 ASP A 253 ? ? -93.76 53.02 72 10 LYS A 286 ? ? -160.26 31.62 73 10 HIS A 305 ? ? -160.88 118.96 74 11 THR A 224 ? ? -82.31 -83.45 75 11 ASP A 244 ? ? -134.73 -63.36 76 11 VAL A 252 ? ? 74.13 143.26 77 11 ASP A 253 ? ? -59.05 104.26 78 11 GLN A 283 ? ? 61.97 -153.95 79 11 LYS A 286 ? ? -133.73 -35.20 80 11 ALA A 293 ? ? -59.18 100.33 81 11 THR A 304 ? ? -149.90 22.17 82 11 HIS A 305 ? ? -174.04 112.63 83 12 THR A 226 ? ? -72.37 -72.05 84 12 LEU A 243 ? ? -107.11 -159.40 85 12 ASP A 244 ? ? -78.21 -155.66 86 12 ASP A 253 ? ? -80.83 40.56 87 12 ASP A 271 ? ? -103.28 -167.51 88 12 THR A 304 ? ? -149.31 19.72 89 12 HIS A 305 ? ? -170.89 115.46 90 12 ALA A 337 ? ? -176.04 27.26 91 13 TRP A 241 ? ? -147.40 -76.72 92 13 GLN A 242 ? ? 58.94 102.69 93 13 ASN A 248 ? ? -78.80 45.17 94 13 ASN A 251 ? ? 65.38 107.57 95 13 VAL A 252 ? ? 70.80 112.29 96 13 ASP A 271 ? ? -100.68 -167.10 97 13 LYS A 286 ? ? -161.87 39.94 98 13 LEU A 289 ? ? -105.68 79.62 99 13 THR A 304 ? ? -147.40 19.99 100 13 HIS A 305 ? ? -172.74 115.82 101 13 SER A 319 ? ? -91.03 34.89 102 14 SER A 223 ? ? 61.51 60.03 103 14 SER A 231 ? ? -107.03 75.15 104 14 TRP A 241 ? ? 70.03 -60.64 105 14 GLN A 242 ? ? 61.50 101.62 106 14 ASP A 244 ? ? -79.67 -86.85 107 14 ASN A 248 ? ? -108.54 47.49 108 14 VAL A 252 ? ? -88.16 36.66 109 14 LEU A 289 ? ? -86.56 38.23 110 14 ALA A 293 ? ? -60.01 98.86 111 14 THR A 304 ? ? -154.08 23.35 112 14 HIS A 305 ? ? -170.67 115.33 113 15 THR A 224 ? ? 65.85 66.98 114 15 THR A 226 ? ? -71.80 -71.88 115 15 SER A 231 ? ? -110.52 74.56 116 15 ASP A 246 ? ? -155.51 -68.72 117 15 ASP A 253 ? ? -165.32 -35.89 118 15 LYS A 286 ? ? -143.93 37.00 119 15 LEU A 289 ? ? -91.35 51.85 120 15 ALA A 293 ? ? -69.29 76.23 121 15 THR A 304 ? ? -146.41 18.04 122 15 HIS A 305 ? ? -171.07 113.99 123 15 SER A 319 ? ? -93.13 33.71 124 16 SER A 231 ? ? -113.07 77.91 125 16 TRP A 241 ? ? -129.86 -51.94 126 16 ARG A 269 ? ? -39.34 119.24 127 16 LEU A 289 ? ? -82.87 48.53 128 16 ALA A 293 ? ? -54.41 98.73 129 16 THR A 304 ? ? -140.06 12.14 130 16 HIS A 305 ? ? -163.03 116.05 131 17 ALA A 225 ? ? 56.09 70.63 132 17 SER A 231 ? ? -102.32 66.89 133 17 TRP A 241 ? ? 67.43 91.51 134 17 LEU A 243 ? ? -82.97 -75.94 135 17 ASP A 244 ? ? -137.02 -70.41 136 17 MET A 284 ? ? -87.79 49.80 137 17 LYS A 286 ? ? -156.32 24.49 138 17 LEU A 289 ? ? -89.06 33.89 139 17 ALA A 293 ? ? -67.62 97.70 140 17 THR A 304 ? ? -147.55 18.09 141 17 HIS A 305 ? ? -169.64 114.70 142 18 SER A 223 ? ? 63.80 -80.16 143 18 THR A 224 ? ? -122.00 -66.51 144 18 LYS A 286 ? ? -141.44 47.37 145 18 LEU A 289 ? ? -100.60 54.96 146 18 ARG A 299 ? ? -172.88 140.62 147 18 THR A 304 ? ? -146.01 13.91 148 18 HIS A 305 ? ? -165.16 116.51 149 18 ASP A 336 ? ? -76.96 25.41 150 18 ALA A 337 ? ? -149.10 30.92 151 19 SER A 231 ? ? -116.41 68.26 152 19 LEU A 243 ? ? 69.34 94.44 153 19 ASN A 248 ? ? 58.54 73.59 154 19 THR A 304 ? ? -140.92 13.57 155 20 TRP A 241 ? ? 70.95 126.19 156 20 LEU A 243 ? ? -109.33 -78.65 157 20 LEU A 289 ? ? -85.00 48.85 158 20 THR A 304 ? ? -148.03 19.85 159 20 HIS A 305 ? ? -167.08 116.93 160 20 ALA A 337 ? ? -152.93 65.31 161 21 SER A 231 ? ? -110.87 74.48 162 21 ASP A 246 ? ? -89.51 40.99 163 21 ASN A 251 ? ? 168.79 119.29 164 21 LYS A 286 ? ? -154.25 -46.60 165 21 LEU A 289 ? ? -84.17 49.51 166 21 THR A 304 ? ? -146.05 16.25 167 21 HIS A 305 ? ? -170.73 115.53 168 22 THR A 224 ? ? -111.35 70.56 169 22 ASP A 244 ? ? 60.83 -171.07 170 22 ALA A 290 ? ? 63.65 168.56 171 22 THR A 304 ? ? -150.75 23.03 172 22 HIS A 305 ? ? -167.78 112.75 173 22 ALA A 337 ? ? -176.60 33.33 174 23 SER A 223 ? ? -93.75 38.92 175 23 THR A 226 ? ? -121.67 -92.37 176 23 GLN A 242 ? ? -81.26 -153.29 177 23 ASP A 246 ? ? -105.44 75.96 178 23 LYS A 249 ? ? -105.06 69.93 179 23 MET A 284 ? ? 71.76 -31.33 180 23 LYS A 286 ? ? -142.91 -36.29 181 23 ALA A 293 ? ? -58.66 108.97 182 23 THR A 304 ? ? -149.11 21.75 183 23 HIS A 305 ? ? -173.41 115.73 184 23 ASP A 336 ? ? -81.36 32.26 185 23 ALA A 337 ? ? -157.94 48.57 186 23 ASN A 344 ? ? -102.03 77.90 187 24 THR A 226 ? ? -90.01 -77.58 188 24 SER A 231 ? ? -100.79 69.57 189 24 TRP A 241 ? ? -88.79 36.69 190 24 GLN A 242 ? ? 63.77 -168.55 191 24 LEU A 243 ? ? 70.49 -73.14 192 24 VAL A 252 ? ? 59.00 75.38 193 24 ASP A 253 ? ? -169.21 -46.25 194 24 ALA A 290 ? ? 61.24 107.19 195 24 THR A 304 ? ? -150.65 20.84 196 24 HIS A 305 ? ? -172.02 115.07 197 24 ASN A 329 ? ? -134.39 -36.60 198 25 THR A 226 ? ? -91.78 -89.53 199 25 TRP A 241 ? ? 175.59 135.30 200 25 ASP A 244 ? ? -141.87 -36.70 201 25 THR A 304 ? ? -145.60 16.79 202 25 HIS A 305 ? ? -170.89 118.32 203 25 ALA A 337 ? ? -141.01 33.58 204 26 SER A 223 ? ? -153.26 -49.78 205 26 LEU A 243 ? ? -176.12 82.98 206 26 VAL A 252 ? ? 65.10 99.00 207 26 LEU A 281 ? ? -71.96 -85.74 208 26 LEU A 289 ? ? -86.77 43.94 209 26 THR A 304 ? ? -142.18 14.57 210 26 HIS A 305 ? ? -164.02 117.45 211 26 ASN A 329 ? ? -138.65 -49.15 212 26 ALA A 337 ? ? -143.62 45.70 213 27 SER A 223 ? ? -86.91 49.83 214 27 LEU A 243 ? ? -109.85 73.13 215 27 ASP A 246 ? ? -159.84 -40.91 216 27 ASN A 248 ? ? -157.63 74.99 217 27 ASP A 271 ? ? -105.74 -166.73 218 27 LYS A 286 ? ? -161.80 -25.03 219 27 LEU A 289 ? ? -91.42 47.03 220 27 ALA A 293 ? ? -66.77 81.84 221 27 ARG A 299 ? ? -170.34 146.82 222 27 THR A 304 ? ? -145.05 16.24 223 27 HIS A 305 ? ? -169.29 117.92 224 27 ASN A 329 ? ? -139.99 -43.53 225 28 SER A 231 ? ? -115.37 64.62 226 28 TRP A 241 ? ? -163.70 -69.96 227 28 GLN A 242 ? ? 60.24 101.94 228 28 ASP A 271 ? ? -113.82 -169.57 229 28 MET A 284 ? ? -97.37 30.21 230 28 LYS A 286 ? ? -153.60 -42.24 231 28 THR A 304 ? ? -145.97 19.93 232 28 HIS A 305 ? ? -165.71 115.75 233 28 ALA A 337 ? ? -147.87 54.94 234 29 SER A 231 ? ? -114.99 78.92 235 29 TRP A 241 ? ? -132.31 -72.86 236 29 GLN A 242 ? ? -161.96 108.17 237 29 ASP A 244 ? ? -128.31 -77.67 238 29 LYS A 249 ? ? 65.34 66.79 239 29 VAL A 250 ? ? 72.11 147.26 240 29 ASP A 253 ? ? -151.81 -42.85 241 29 LYS A 286 ? ? -138.93 -38.83 242 29 LEU A 289 ? ? -92.24 54.11 243 29 THR A 304 ? ? -148.98 18.53 244 29 HIS A 305 ? ? -169.43 113.59 245 29 ASP A 336 ? ? -78.99 26.27 246 29 ALA A 337 ? ? -154.49 41.13 247 30 LEU A 243 ? ? -144.46 30.08 248 30 ASP A 244 ? ? 60.09 -154.58 249 30 ASP A 253 ? ? -165.59 -44.23 250 30 LYS A 286 ? ? -145.27 -32.17 251 30 ASP A 336 ? ? -79.44 23.25 252 30 ALA A 337 ? ? -155.42 46.46 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M5S _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M5S _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.5 mM [U-100% 13C; U-100% 15N] protein, 20 mM sodium phosphate, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.5 mM [U-100% 13C; U-100% 15N] protein, 20 mM sodium phosphate, 1% H2O/99% D2O' 2 '1% H2O/99% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Protein-1 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 'Sodium Phosphate-2' 20 ? mM ? 1 Protein-3 1.5 ? mM '[U-100% 13C; U-100% 15N]' 2 'Sodium Phosphate-4' 20 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CA)CO' 1 7 2 '3D CCH-TOCSY' 1 8 2 '3D HCCH-TOCSY' 1 9 1 '3D HNHB' 1 10 1 '3D Long-range HNCO' 1 11 1 '3D HNHA' 1 12 1 '3D 1H-15N TOCSY' 1 13 2 '3D 1H-13C NOESY' 1 14 1 '3D 1H-15N NOESY' # _pdbx_nmr_refine.entry_id 2M5S _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ;Automated assignment of NOE spectra was carried out using ARIA using floating chirality. CCPNmr Analysis was used to inspect violations and refine the structure for further calculations with ARIA. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ? 'peak picking' ARIA 2.3.1 1 ? refinement ARIA/CNS/CCPNmr_Analysis ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 216 ? A HIS 1 2 1 Y 1 A HIS 217 ? A HIS 2 3 1 Y 1 A HIS 218 ? A HIS 3 4 1 Y 1 A HIS 219 ? A HIS 4 5 1 Y 1 A HIS 220 ? A HIS 5 6 1 Y 1 A HIS 221 ? A HIS 6 7 2 Y 1 A HIS 216 ? A HIS 1 8 2 Y 1 A HIS 217 ? A HIS 2 9 2 Y 1 A HIS 218 ? A HIS 3 10 2 Y 1 A HIS 219 ? A HIS 4 11 2 Y 1 A HIS 220 ? A HIS 5 12 2 Y 1 A HIS 221 ? A HIS 6 13 3 Y 1 A HIS 216 ? A HIS 1 14 3 Y 1 A HIS 217 ? A HIS 2 15 3 Y 1 A HIS 218 ? A HIS 3 16 3 Y 1 A HIS 219 ? A HIS 4 17 3 Y 1 A HIS 220 ? A HIS 5 18 3 Y 1 A HIS 221 ? A HIS 6 19 4 Y 1 A HIS 216 ? A HIS 1 20 4 Y 1 A HIS 217 ? A HIS 2 21 4 Y 1 A HIS 218 ? A HIS 3 22 4 Y 1 A HIS 219 ? A HIS 4 23 4 Y 1 A HIS 220 ? A HIS 5 24 4 Y 1 A HIS 221 ? A HIS 6 25 5 Y 1 A HIS 216 ? A HIS 1 26 5 Y 1 A HIS 217 ? A HIS 2 27 5 Y 1 A HIS 218 ? A HIS 3 28 5 Y 1 A HIS 219 ? A HIS 4 29 5 Y 1 A HIS 220 ? A HIS 5 30 5 Y 1 A HIS 221 ? A HIS 6 31 6 Y 1 A HIS 216 ? A HIS 1 32 6 Y 1 A HIS 217 ? A HIS 2 33 6 Y 1 A HIS 218 ? A HIS 3 34 6 Y 1 A HIS 219 ? A HIS 4 35 6 Y 1 A HIS 220 ? A HIS 5 36 6 Y 1 A HIS 221 ? A HIS 6 37 7 Y 1 A HIS 216 ? A HIS 1 38 7 Y 1 A HIS 217 ? A HIS 2 39 7 Y 1 A HIS 218 ? A HIS 3 40 7 Y 1 A HIS 219 ? A HIS 4 41 7 Y 1 A HIS 220 ? A HIS 5 42 7 Y 1 A HIS 221 ? A HIS 6 43 8 Y 1 A HIS 216 ? A HIS 1 44 8 Y 1 A HIS 217 ? A HIS 2 45 8 Y 1 A HIS 218 ? A HIS 3 46 8 Y 1 A HIS 219 ? A HIS 4 47 8 Y 1 A HIS 220 ? A HIS 5 48 8 Y 1 A HIS 221 ? A HIS 6 49 9 Y 1 A HIS 216 ? A HIS 1 50 9 Y 1 A HIS 217 ? A HIS 2 51 9 Y 1 A HIS 218 ? A HIS 3 52 9 Y 1 A HIS 219 ? A HIS 4 53 9 Y 1 A HIS 220 ? A HIS 5 54 9 Y 1 A HIS 221 ? A HIS 6 55 10 Y 1 A HIS 216 ? A HIS 1 56 10 Y 1 A HIS 217 ? A HIS 2 57 10 Y 1 A HIS 218 ? A HIS 3 58 10 Y 1 A HIS 219 ? A HIS 4 59 10 Y 1 A HIS 220 ? A HIS 5 60 10 Y 1 A HIS 221 ? A HIS 6 61 11 Y 1 A HIS 216 ? A HIS 1 62 11 Y 1 A HIS 217 ? A HIS 2 63 11 Y 1 A HIS 218 ? A HIS 3 64 11 Y 1 A HIS 219 ? A HIS 4 65 11 Y 1 A HIS 220 ? A HIS 5 66 11 Y 1 A HIS 221 ? A HIS 6 67 12 Y 1 A HIS 216 ? A HIS 1 68 12 Y 1 A HIS 217 ? A HIS 2 69 12 Y 1 A HIS 218 ? A HIS 3 70 12 Y 1 A HIS 219 ? A HIS 4 71 12 Y 1 A HIS 220 ? A HIS 5 72 12 Y 1 A HIS 221 ? A HIS 6 73 13 Y 1 A HIS 216 ? A HIS 1 74 13 Y 1 A HIS 217 ? A HIS 2 75 13 Y 1 A HIS 218 ? A HIS 3 76 13 Y 1 A HIS 219 ? A HIS 4 77 13 Y 1 A HIS 220 ? A HIS 5 78 13 Y 1 A HIS 221 ? A HIS 6 79 14 Y 1 A HIS 216 ? A HIS 1 80 14 Y 1 A HIS 217 ? A HIS 2 81 14 Y 1 A HIS 218 ? A HIS 3 82 14 Y 1 A HIS 219 ? A HIS 4 83 14 Y 1 A HIS 220 ? A HIS 5 84 14 Y 1 A HIS 221 ? A HIS 6 85 15 Y 1 A HIS 216 ? A HIS 1 86 15 Y 1 A HIS 217 ? A HIS 2 87 15 Y 1 A HIS 218 ? A HIS 3 88 15 Y 1 A HIS 219 ? A HIS 4 89 15 Y 1 A HIS 220 ? A HIS 5 90 15 Y 1 A HIS 221 ? A HIS 6 91 16 Y 1 A HIS 216 ? A HIS 1 92 16 Y 1 A HIS 217 ? A HIS 2 93 16 Y 1 A HIS 218 ? A HIS 3 94 16 Y 1 A HIS 219 ? A HIS 4 95 16 Y 1 A HIS 220 ? A HIS 5 96 16 Y 1 A HIS 221 ? A HIS 6 97 17 Y 1 A HIS 216 ? A HIS 1 98 17 Y 1 A HIS 217 ? A HIS 2 99 17 Y 1 A HIS 218 ? A HIS 3 100 17 Y 1 A HIS 219 ? A HIS 4 101 17 Y 1 A HIS 220 ? A HIS 5 102 17 Y 1 A HIS 221 ? A HIS 6 103 18 Y 1 A HIS 216 ? A HIS 1 104 18 Y 1 A HIS 217 ? A HIS 2 105 18 Y 1 A HIS 218 ? A HIS 3 106 18 Y 1 A HIS 219 ? A HIS 4 107 18 Y 1 A HIS 220 ? A HIS 5 108 18 Y 1 A HIS 221 ? A HIS 6 109 19 Y 1 A HIS 216 ? A HIS 1 110 19 Y 1 A HIS 217 ? A HIS 2 111 19 Y 1 A HIS 218 ? A HIS 3 112 19 Y 1 A HIS 219 ? A HIS 4 113 19 Y 1 A HIS 220 ? A HIS 5 114 19 Y 1 A HIS 221 ? A HIS 6 115 20 Y 1 A HIS 216 ? A HIS 1 116 20 Y 1 A HIS 217 ? A HIS 2 117 20 Y 1 A HIS 218 ? A HIS 3 118 20 Y 1 A HIS 219 ? A HIS 4 119 20 Y 1 A HIS 220 ? A HIS 5 120 20 Y 1 A HIS 221 ? A HIS 6 121 21 Y 1 A HIS 216 ? A HIS 1 122 21 Y 1 A HIS 217 ? A HIS 2 123 21 Y 1 A HIS 218 ? A HIS 3 124 21 Y 1 A HIS 219 ? A HIS 4 125 21 Y 1 A HIS 220 ? A HIS 5 126 21 Y 1 A HIS 221 ? A HIS 6 127 22 Y 1 A HIS 216 ? A HIS 1 128 22 Y 1 A HIS 217 ? A HIS 2 129 22 Y 1 A HIS 218 ? A HIS 3 130 22 Y 1 A HIS 219 ? A HIS 4 131 22 Y 1 A HIS 220 ? A HIS 5 132 22 Y 1 A HIS 221 ? A HIS 6 133 23 Y 1 A HIS 216 ? A HIS 1 134 23 Y 1 A HIS 217 ? A HIS 2 135 23 Y 1 A HIS 218 ? A HIS 3 136 23 Y 1 A HIS 219 ? A HIS 4 137 23 Y 1 A HIS 220 ? A HIS 5 138 23 Y 1 A HIS 221 ? A HIS 6 139 24 Y 1 A HIS 216 ? A HIS 1 140 24 Y 1 A HIS 217 ? A HIS 2 141 24 Y 1 A HIS 218 ? A HIS 3 142 24 Y 1 A HIS 219 ? A HIS 4 143 24 Y 1 A HIS 220 ? A HIS 5 144 24 Y 1 A HIS 221 ? A HIS 6 145 25 Y 1 A HIS 216 ? A HIS 1 146 25 Y 1 A HIS 217 ? A HIS 2 147 25 Y 1 A HIS 218 ? A HIS 3 148 25 Y 1 A HIS 219 ? A HIS 4 149 25 Y 1 A HIS 220 ? A HIS 5 150 25 Y 1 A HIS 221 ? A HIS 6 151 26 Y 1 A HIS 216 ? A HIS 1 152 26 Y 1 A HIS 217 ? A HIS 2 153 26 Y 1 A HIS 218 ? A HIS 3 154 26 Y 1 A HIS 219 ? A HIS 4 155 26 Y 1 A HIS 220 ? A HIS 5 156 26 Y 1 A HIS 221 ? A HIS 6 157 27 Y 1 A HIS 216 ? A HIS 1 158 27 Y 1 A HIS 217 ? A HIS 2 159 27 Y 1 A HIS 218 ? A HIS 3 160 27 Y 1 A HIS 219 ? A HIS 4 161 27 Y 1 A HIS 220 ? A HIS 5 162 27 Y 1 A HIS 221 ? A HIS 6 163 28 Y 1 A HIS 216 ? A HIS 1 164 28 Y 1 A HIS 217 ? A HIS 2 165 28 Y 1 A HIS 218 ? A HIS 3 166 28 Y 1 A HIS 219 ? A HIS 4 167 28 Y 1 A HIS 220 ? A HIS 5 168 28 Y 1 A HIS 221 ? A HIS 6 169 29 Y 1 A HIS 216 ? A HIS 1 170 29 Y 1 A HIS 217 ? A HIS 2 171 29 Y 1 A HIS 218 ? A HIS 3 172 29 Y 1 A HIS 219 ? A HIS 4 173 29 Y 1 A HIS 220 ? A HIS 5 174 29 Y 1 A HIS 221 ? A HIS 6 175 30 Y 1 A HIS 216 ? A HIS 1 176 30 Y 1 A HIS 217 ? A HIS 2 177 30 Y 1 A HIS 218 ? A HIS 3 178 30 Y 1 A HIS 219 ? A HIS 4 179 30 Y 1 A HIS 220 ? A HIS 5 180 30 Y 1 A HIS 221 ? A HIS 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2M5S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_