data_2M65 # _entry.id 2M65 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M65 pdb_00002m65 10.2210/pdb2m65/pdb RCSB RCSB103257 ? ? BMRB 19108 ? ? WWPDB D_1000103257 ? ? # _pdbx_database_related.db_id 19108 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M65 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-03-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Byeon, I.L.' 1 'Byeon, C.' 2 'Ahn, J.' 3 'Gronenborn, A.M.' 4 # _citation.id primary _citation.title 'NMR structure of human restriction factor APOBEC3A reveals substrate binding and enzyme specificity.' _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 4 _citation.page_first 1890 _citation.page_last 1890 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23695684 _citation.pdbx_database_id_DOI 10.1038/ncomms2883 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Byeon, I.J.' 1 ? primary 'Ahn, J.' 2 ? primary 'Mitra, M.' 3 ? primary 'Byeon, C.H.' 4 ? primary 'Hercik, K.' 5 ? primary 'Hritz, J.' 6 ? primary 'Charlton, L.M.' 7 ? primary 'Levin, J.G.' 8 ? primary 'Gronenborn, A.M.' 9 ? # _cell.entry_id 2M65 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M65 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable DNA dC->dU-editing enzyme APOBEC-3A' 24112.170 1 3.5.4.- ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Phorbolin-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVP SLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKH CWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVP SLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKH CWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 SER n 1 5 PRO n 1 6 ALA n 1 7 SER n 1 8 GLY n 1 9 PRO n 1 10 ARG n 1 11 HIS n 1 12 LEU n 1 13 MET n 1 14 ASP n 1 15 PRO n 1 16 HIS n 1 17 ILE n 1 18 PHE n 1 19 THR n 1 20 SER n 1 21 ASN n 1 22 PHE n 1 23 ASN n 1 24 ASN n 1 25 GLY n 1 26 ILE n 1 27 GLY n 1 28 ARG n 1 29 HIS n 1 30 LYS n 1 31 THR n 1 32 TYR n 1 33 LEU n 1 34 CYS n 1 35 TYR n 1 36 GLU n 1 37 VAL n 1 38 GLU n 1 39 ARG n 1 40 LEU n 1 41 ASP n 1 42 ASN n 1 43 GLY n 1 44 THR n 1 45 SER n 1 46 VAL n 1 47 LYS n 1 48 MET n 1 49 ASP n 1 50 GLN n 1 51 HIS n 1 52 ARG n 1 53 GLY n 1 54 PHE n 1 55 LEU n 1 56 HIS n 1 57 ASN n 1 58 GLN n 1 59 ALA n 1 60 LYS n 1 61 ASN n 1 62 LEU n 1 63 LEU n 1 64 CYS n 1 65 GLY n 1 66 PHE n 1 67 TYR n 1 68 GLY n 1 69 ARG n 1 70 HIS n 1 71 ALA n 1 72 GLU n 1 73 LEU n 1 74 ARG n 1 75 PHE n 1 76 LEU n 1 77 ASP n 1 78 LEU n 1 79 VAL n 1 80 PRO n 1 81 SER n 1 82 LEU n 1 83 GLN n 1 84 LEU n 1 85 ASP n 1 86 PRO n 1 87 ALA n 1 88 GLN n 1 89 ILE n 1 90 TYR n 1 91 ARG n 1 92 VAL n 1 93 THR n 1 94 TRP n 1 95 PHE n 1 96 ILE n 1 97 SER n 1 98 TRP n 1 99 SER n 1 100 PRO n 1 101 CYS n 1 102 PHE n 1 103 SER n 1 104 TRP n 1 105 GLY n 1 106 CYS n 1 107 ALA n 1 108 GLY n 1 109 GLU n 1 110 VAL n 1 111 ARG n 1 112 ALA n 1 113 PHE n 1 114 LEU n 1 115 GLN n 1 116 GLU n 1 117 ASN n 1 118 THR n 1 119 HIS n 1 120 VAL n 1 121 ARG n 1 122 LEU n 1 123 ARG n 1 124 ILE n 1 125 PHE n 1 126 ALA n 1 127 ALA n 1 128 ARG n 1 129 ILE n 1 130 TYR n 1 131 ASP n 1 132 TYR n 1 133 ASP n 1 134 PRO n 1 135 LEU n 1 136 TYR n 1 137 LYS n 1 138 GLU n 1 139 ALA n 1 140 LEU n 1 141 GLN n 1 142 MET n 1 143 LEU n 1 144 ARG n 1 145 ASP n 1 146 ALA n 1 147 GLY n 1 148 ALA n 1 149 GLN n 1 150 VAL n 1 151 SER n 1 152 ILE n 1 153 MET n 1 154 THR n 1 155 TYR n 1 156 ASP n 1 157 GLU n 1 158 PHE n 1 159 LYS n 1 160 HIS n 1 161 CYS n 1 162 TRP n 1 163 ASP n 1 164 THR n 1 165 PHE n 1 166 VAL n 1 167 ASP n 1 168 HIS n 1 169 GLN n 1 170 GLY n 1 171 CYS n 1 172 PRO n 1 173 PHE n 1 174 GLN n 1 175 PRO n 1 176 TRP n 1 177 ASP n 1 178 GLY n 1 179 LEU n 1 180 ASP n 1 181 GLU n 1 182 HIS n 1 183 SER n 1 184 GLN n 1 185 ALA n 1 186 LEU n 1 187 SER n 1 188 GLY n 1 189 ARG n 1 190 LEU n 1 191 ARG n 1 192 ALA n 1 193 ILE n 1 194 LEU n 1 195 GLN n 1 196 ASN n 1 197 GLN n 1 198 GLY n 1 199 ASN n 1 200 LEU n 1 201 GLU n 1 202 HIS n 1 203 HIS n 1 204 HIS n 1 205 HIS n 1 206 HIS n 1 207 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene APOBEC3A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABC3A_HUMAN _struct_ref.pdbx_db_accession P31941 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVP SLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKH CWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M65 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 199 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31941 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 199 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 199 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M65 LEU A 200 ? UNP P31941 ? ? 'expression tag' 200 1 1 2M65 GLU A 201 ? UNP P31941 ? ? 'expression tag' 201 2 1 2M65 HIS A 202 ? UNP P31941 ? ? 'expression tag' 202 3 1 2M65 HIS A 203 ? UNP P31941 ? ? 'expression tag' 203 4 1 2M65 HIS A 204 ? UNP P31941 ? ? 'expression tag' 204 5 1 2M65 HIS A 205 ? UNP P31941 ? ? 'expression tag' 205 6 1 2M65 HIS A 206 ? UNP P31941 ? ? 'expression tag' 206 7 1 2M65 HIS A 207 ? UNP P31941 ? ? 'expression tag' 207 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HN(CO)CA' 1 4 1 '3D HNCACB' 1 5 1 '3D HN(COCA)CB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D simulaneous 1H-13C and 1H-15N NOESY' 1 8 1 '2D 1H-15N HSQC' 1 9 1 '3D HNCA' 1 10 1 '3D HN(CO)CA' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D simultaneous 1H-13C and 1H-15N NOESY' 1 13 1 '2D 1H-15N HSQC' 1 14 1 '3D HCCH-TOCSY' 1 15 1 '3D simulaneous 1H-13C and 1H-15N NOESY' 1 16 1 '2D 1H-15N HSQC' 1 17 1 '3D HNCACB' 1 18 1 '3D HN(COCA)CB' 1 19 1 '3D simultaneous 1H-13C and 1H-15N NOESY' 1 20 1 '2D 1H-13C HSQC aliphatic' 1 21 1 '2D 1H-15N HSQC' 1 22 1 '3D simultaneous 1H-13C and 1H-15N NOESY' 1 23 1 '2D 1H-13C HSQC aliphatic' 1 24 1 '2D 1H-1H NOESY' 1 25 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '13C,15N-APOBEC3A, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 600 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M65 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 512 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M65 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M65 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_software.authors 'Schwieters, C.D. et al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name 'X-PLOR NIH' _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M65 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M65 _struct.title 'NMR structure of human restriction factor APOBEC3A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M65 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'APOBEC3A, Cytidine deaminase, Antiviral defense, HOST-VIRUS INTERACTION, Zinc-binding, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 14 ? PHE A 22 ? ASP A 14 PHE A 22 1 ? 9 HELX_P HELX_P2 2 HIS A 70 ? ASP A 77 ? HIS A 70 ASP A 77 1 ? 8 HELX_P HELX_P3 3 LEU A 78 ? GLN A 83 ? LEU A 78 GLN A 83 1 ? 6 HELX_P HELX_P4 4 GLY A 105 ? THR A 118 ? GLY A 105 THR A 118 1 ? 14 HELX_P HELX_P5 5 LEU A 135 ? ASP A 145 ? LEU A 135 ASP A 145 1 ? 11 HELX_P HELX_P6 6 THR A 154 ? VAL A 166 ? THR A 154 VAL A 166 1 ? 13 HELX_P HELX_P7 7 GLY A 178 ? GLN A 195 ? GLY A 178 GLN A 195 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 70 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 70 A ZN 300 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc2 metalc ? ? A CYS 101 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 101 A ZN 300 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc3 metalc ? ? A CYS 106 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 106 A ZN 300 1_555 ? ? ? ? ? ? ? 2.303 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 44 ? LYS A 47 ? THR A 44 LYS A 47 A 2 TYR A 32 ? ASP A 41 ? TYR A 32 ASP A 41 A 3 GLY A 53 ? HIS A 56 ? GLY A 53 HIS A 56 B 1 THR A 44 ? LYS A 47 ? THR A 44 LYS A 47 B 2 TYR A 32 ? ASP A 41 ? TYR A 32 ASP A 41 B 3 ILE A 89 ? TRP A 98 ? ILE A 89 TRP A 98 B 4 VAL A 120 ? ARG A 128 ? VAL A 120 ARG A 128 B 5 GLN A 149 ? ILE A 152 ? GLN A 149 ILE A 152 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 46 ? O VAL A 46 N ARG A 39 ? N ARG A 39 A 2 3 N LEU A 33 ? N LEU A 33 O LEU A 55 ? O LEU A 55 B 1 2 O VAL A 46 ? O VAL A 46 N ARG A 39 ? N ARG A 39 B 2 3 N GLU A 38 ? N GLU A 38 O ARG A 91 ? O ARG A 91 B 3 4 N ILE A 96 ? N ILE A 96 O ALA A 127 ? O ALA A 127 B 4 5 N ILE A 124 ? N ILE A 124 O GLN A 149 ? O GLN A 149 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 70 ? HIS A 70 . ? 1_555 ? 2 AC1 3 CYS A 101 ? CYS A 101 . ? 1_555 ? 3 AC1 3 CYS A 106 ? CYS A 106 . ? 1_555 ? # _atom_sites.entry_id 2M65 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 TRP 176 176 176 TRP TRP A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 GLN 197 197 197 GLN GLN A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 LEU 200 200 ? ? ? A . n A 1 201 GLU 201 201 ? ? ? A . n A 1 202 HIS 202 202 ? ? ? A . n A 1 203 HIS 203 203 ? ? ? A . n A 1 204 HIS 204 204 ? ? ? A . n A 1 205 HIS 205 205 ? ? ? A . n A 1 206 HIS 206 206 ? ? ? A . n A 1 207 HIS 207 207 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 300 _pdbx_nonpoly_scheme.auth_seq_num 300 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 108.9 ? 2 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 106 ? A CYS 106 ? 1_555 109.1 ? 3 SG ? A CYS 101 ? A CYS 101 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 106 ? A CYS 106 ? 1_555 109.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-22 2 'Structure model' 1 1 2013-06-05 3 'Structure model' 1 2 2013-06-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HH12 A ARG 91 ? ? HE22 A GLN 149 ? ? 1.33 2 9 HE22 A GLN 58 ? ? HE A ARG 69 ? ? 1.27 3 11 H A GLY 25 ? ? HH12 A ARG 128 ? ? 1.27 4 15 HE22 A GLN 149 ? ? HG A SER 151 ? ? 1.33 5 16 HE A ARG 39 ? ? HH A TYR 90 ? ? 1.34 6 17 O A PHE 102 ? ? H A GLY 105 ? ? 1.60 7 19 HG A SER 7 ? ? H A GLY 8 ? ? 1.33 8 20 HG A SER 45 ? ? HH21 A ARG 91 ? ? 1.33 9 21 H1 A MET 1 ? ? H A GLU 2 ? ? 1.31 10 24 HE A ARG 28 ? ? H A HIS 29 ? ? 1.28 11 24 O A PHE 102 ? ? H A GLY 105 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -161.18 102.88 2 1 ALA A 3 ? ? 43.03 -99.55 3 1 SER A 7 ? ? -104.98 -115.74 4 1 PRO A 9 ? ? -76.61 28.96 5 1 ARG A 10 ? ? -77.06 -136.31 6 1 HIS A 11 ? ? -107.42 73.79 7 1 ASN A 23 ? ? -50.09 95.89 8 1 ILE A 26 ? ? -108.12 -165.92 9 1 ARG A 28 ? ? -172.02 120.16 10 1 HIS A 29 ? ? -164.70 -86.05 11 1 LYS A 30 ? ? -172.94 110.91 12 1 GLN A 50 ? ? -102.20 71.65 13 1 HIS A 51 ? ? -166.76 -12.20 14 1 ASN A 57 ? ? -40.81 162.95 15 1 ALA A 59 ? ? -160.29 68.22 16 1 LYS A 60 ? ? -147.49 14.71 17 1 ASN A 61 ? ? -143.24 23.62 18 1 TYR A 67 ? ? -46.33 162.45 19 1 LEU A 76 ? ? -49.82 -19.89 20 1 LEU A 84 ? ? -38.75 155.98 21 1 PRO A 86 ? ? -49.10 -7.38 22 1 CYS A 101 ? ? -107.77 -131.73 23 1 PHE A 102 ? ? -56.22 99.69 24 1 SER A 103 ? ? -38.55 -25.17 25 1 THR A 118 ? ? -66.31 4.60 26 1 TYR A 130 ? ? -172.62 119.68 27 1 PRO A 134 ? ? -69.72 3.80 28 1 TRP A 162 ? ? -64.17 -70.13 29 1 ASP A 167 ? ? -80.84 35.20 30 1 HIS A 168 ? ? -45.49 -13.46 31 1 GLN A 169 ? ? 48.06 12.96 32 2 GLU A 2 ? ? -69.04 65.22 33 2 ALA A 6 ? ? -172.40 -141.32 34 2 SER A 7 ? ? 55.05 -127.70 35 2 PRO A 9 ? ? -72.05 22.69 36 2 ARG A 10 ? ? 60.48 154.62 37 2 HIS A 11 ? ? -161.55 99.00 38 2 LYS A 30 ? ? -172.81 62.15 39 2 HIS A 51 ? ? -171.51 9.89 40 2 ASN A 57 ? ? -70.34 -162.13 41 2 GLN A 58 ? ? 51.76 172.92 42 2 ALA A 59 ? ? -164.88 -22.29 43 2 LYS A 60 ? ? 60.67 96.68 44 2 LEU A 62 ? ? -43.31 -15.94 45 2 PHE A 66 ? ? -158.77 65.49 46 2 ALA A 87 ? ? -42.11 -94.87 47 2 PRO A 100 ? ? -42.34 172.10 48 2 PHE A 102 ? ? -171.48 109.21 49 2 ASN A 117 ? ? -164.29 61.88 50 2 THR A 118 ? ? -59.29 2.84 51 2 LEU A 135 ? ? -66.42 4.57 52 2 TRP A 162 ? ? -70.86 -70.09 53 2 ASP A 167 ? ? -75.70 32.54 54 2 GLN A 169 ? ? 41.32 15.55 55 2 GLN A 197 ? ? -55.71 -88.44 56 3 ALA A 3 ? ? -68.96 -150.92 57 3 PRO A 5 ? ? -49.03 152.81 58 3 ALA A 6 ? ? -97.05 40.68 59 3 ARG A 10 ? ? -109.27 45.44 60 3 ASN A 24 ? ? 56.55 173.26 61 3 HIS A 29 ? ? -160.00 -79.79 62 3 LYS A 30 ? ? -178.86 111.43 63 3 GLN A 50 ? ? -100.15 73.93 64 3 HIS A 51 ? ? -172.85 -7.07 65 3 GLN A 58 ? ? 57.41 82.14 66 3 ALA A 59 ? ? -85.13 -133.78 67 3 PHE A 66 ? ? -61.51 74.71 68 3 SER A 81 ? ? -59.35 -9.01 69 3 ALA A 87 ? ? -41.31 -83.24 70 3 CYS A 101 ? ? -111.96 -139.13 71 3 PHE A 102 ? ? -46.66 95.91 72 3 SER A 103 ? ? -39.36 -25.29 73 3 GLN A 115 ? ? -47.88 -15.06 74 3 THR A 118 ? ? -45.49 -15.50 75 3 TYR A 130 ? ? -166.52 116.55 76 3 PRO A 134 ? ? -70.93 44.24 77 3 MET A 153 ? ? -41.61 105.64 78 3 TRP A 162 ? ? -75.08 -70.52 79 3 ASP A 167 ? ? -80.82 42.96 80 3 HIS A 168 ? ? -53.27 -8.52 81 3 GLN A 169 ? ? 46.79 13.44 82 3 GLN A 195 ? ? 75.88 -44.42 83 4 ALA A 3 ? ? 73.68 38.56 84 4 SER A 7 ? ? 55.82 109.98 85 4 ARG A 10 ? ? 40.08 -104.72 86 4 HIS A 11 ? ? -173.33 107.47 87 4 HIS A 29 ? ? -105.79 60.92 88 4 LYS A 30 ? ? -150.72 52.71 89 4 HIS A 51 ? ? -170.95 2.04 90 4 ASN A 57 ? ? -51.40 -175.05 91 4 ALA A 59 ? ? -139.88 -77.57 92 4 ASN A 61 ? ? -87.04 33.31 93 4 PHE A 66 ? ? -152.24 71.65 94 4 LEU A 76 ? ? -47.32 -18.99 95 4 LEU A 84 ? ? -42.40 104.68 96 4 PRO A 100 ? ? -42.48 172.92 97 4 PHE A 102 ? ? 76.27 86.38 98 4 GLN A 115 ? ? -46.66 -19.66 99 4 TRP A 162 ? ? -73.96 -70.30 100 4 ASP A 167 ? ? -72.56 41.06 101 4 HIS A 168 ? ? -52.51 -8.72 102 4 GLN A 169 ? ? 46.68 14.38 103 4 ASP A 177 ? ? -45.33 95.21 104 5 ALA A 3 ? ? -98.77 -99.31 105 5 SER A 4 ? ? -171.14 69.72 106 5 ASN A 23 ? ? -68.46 74.05 107 5 ASN A 24 ? ? 46.72 -136.50 108 5 HIS A 29 ? ? -63.61 80.80 109 5 LYS A 30 ? ? -166.90 36.96 110 5 THR A 31 ? ? -46.52 155.79 111 5 GLN A 50 ? ? -76.72 49.81 112 5 HIS A 51 ? ? -169.91 67.02 113 5 LYS A 60 ? ? -172.52 94.97 114 5 LEU A 62 ? ? -45.72 -13.73 115 5 PHE A 66 ? ? -155.30 -66.63 116 5 TYR A 67 ? ? -49.10 160.55 117 5 GLN A 83 ? ? 81.59 46.57 118 5 ALA A 87 ? ? -40.10 -77.41 119 5 PRO A 100 ? ? -42.27 171.45 120 5 GLN A 115 ? ? -48.06 -19.60 121 5 TYR A 130 ? ? -177.63 126.14 122 5 ASP A 131 ? ? 174.59 133.90 123 5 PRO A 134 ? ? -51.61 -1.81 124 5 LEU A 135 ? ? -54.36 -6.03 125 5 ASP A 167 ? ? -73.68 36.36 126 5 HIS A 168 ? ? -49.25 -11.37 127 5 GLN A 169 ? ? 49.30 9.75 128 5 ASP A 177 ? ? -64.85 86.67 129 5 GLN A 195 ? ? 70.91 -61.28 130 5 ASN A 196 ? ? -82.73 -131.11 131 6 GLU A 2 ? ? -66.57 -162.05 132 6 PRO A 5 ? ? -69.82 -83.76 133 6 ALA A 6 ? ? 168.49 104.78 134 6 HIS A 11 ? ? 77.10 33.77 135 6 HIS A 29 ? ? -107.54 69.52 136 6 GLN A 50 ? ? -108.70 77.08 137 6 HIS A 51 ? ? -167.78 1.84 138 6 ALA A 59 ? ? -152.20 -139.55 139 6 LYS A 60 ? ? 54.28 178.13 140 6 ASN A 61 ? ? 43.10 28.01 141 6 SER A 99 ? ? -47.65 162.15 142 6 CYS A 101 ? ? -100.83 -149.13 143 6 PHE A 102 ? ? -41.23 107.72 144 6 GLN A 115 ? ? -46.70 -16.13 145 6 ASN A 117 ? ? -98.89 35.43 146 6 THR A 118 ? ? -45.53 -15.66 147 6 PRO A 134 ? ? -70.18 25.13 148 6 GLN A 169 ? ? 37.41 74.24 149 6 GLN A 197 ? ? 65.26 -147.72 150 7 GLU A 2 ? ? 64.81 131.26 151 7 ALA A 3 ? ? -139.72 -66.82 152 7 SER A 4 ? ? -173.13 67.32 153 7 ALA A 6 ? ? 50.57 95.01 154 7 SER A 7 ? ? -68.32 -100.56 155 7 HIS A 11 ? ? 40.36 95.19 156 7 PRO A 15 ? ? -42.04 -17.64 157 7 ASN A 24 ? ? 61.54 150.50 158 7 LYS A 30 ? ? -173.00 34.46 159 7 THR A 31 ? ? -46.71 160.68 160 7 HIS A 51 ? ? -169.37 22.21 161 7 ALA A 59 ? ? -175.88 57.05 162 7 ASN A 61 ? ? 40.81 28.54 163 7 PHE A 66 ? ? -170.84 60.16 164 7 LEU A 84 ? ? -43.15 155.12 165 7 PRO A 86 ? ? -49.79 -7.16 166 7 CYS A 101 ? ? -111.14 -137.20 167 7 PHE A 102 ? ? -49.49 102.49 168 7 ASN A 117 ? ? -144.02 34.24 169 7 THR A 118 ? ? -62.27 3.01 170 7 TYR A 130 ? ? -174.42 120.09 171 7 PRO A 134 ? ? -49.75 -6.84 172 7 LEU A 135 ? ? -55.73 -6.05 173 7 ASP A 167 ? ? -75.98 27.75 174 7 GLN A 169 ? ? 41.16 17.06 175 7 ASN A 196 ? ? -67.50 -162.11 176 8 GLU A 2 ? ? -143.33 -42.89 177 8 ALA A 6 ? ? -65.15 -76.50 178 8 ARG A 10 ? ? 55.89 -157.34 179 8 HIS A 11 ? ? -151.55 54.70 180 8 ASN A 24 ? ? -39.39 121.12 181 8 ARG A 28 ? ? -171.56 147.01 182 8 THR A 31 ? ? -47.27 109.50 183 8 GLN A 50 ? ? -100.78 63.07 184 8 HIS A 51 ? ? -161.00 13.07 185 8 ASN A 57 ? ? -41.73 150.55 186 8 GLN A 58 ? ? -96.32 -60.89 187 8 ALA A 59 ? ? 54.58 101.92 188 8 ASN A 61 ? ? -38.26 103.17 189 8 PHE A 66 ? ? -130.87 -80.13 190 8 SER A 81 ? ? -56.89 -8.84 191 8 GLN A 83 ? ? 71.26 39.58 192 8 ALA A 87 ? ? -40.00 -84.99 193 8 SER A 99 ? ? -46.49 162.41 194 8 CYS A 101 ? ? -117.43 -151.26 195 8 PHE A 102 ? ? -37.75 98.55 196 8 SER A 103 ? ? -39.06 -24.02 197 8 GLN A 115 ? ? -46.80 -15.57 198 8 ASN A 117 ? ? -152.54 57.74 199 8 THR A 118 ? ? -62.14 5.48 200 8 TYR A 130 ? ? -178.82 122.49 201 8 ASP A 131 ? ? 179.68 151.71 202 8 PRO A 134 ? ? -50.04 -5.83 203 8 LEU A 135 ? ? -52.66 -8.98 204 8 ASP A 167 ? ? -75.16 39.31 205 8 HIS A 168 ? ? -46.87 -12.81 206 8 GLN A 169 ? ? 53.83 6.19 207 8 TRP A 176 ? ? -103.53 -168.29 208 8 LEU A 194 ? ? -59.19 -6.23 209 8 GLN A 195 ? ? 48.81 99.76 210 8 GLN A 197 ? ? 47.96 83.17 211 9 GLU A 2 ? ? -165.67 -40.58 212 9 ALA A 3 ? ? -162.59 -66.66 213 9 SER A 4 ? ? 57.91 163.22 214 9 PRO A 5 ? ? -38.26 120.38 215 9 SER A 7 ? ? 171.91 97.81 216 9 HIS A 11 ? ? 41.56 94.03 217 9 ASN A 24 ? ? -41.21 155.63 218 9 HIS A 29 ? ? -61.91 76.33 219 9 GLN A 50 ? ? -103.29 73.09 220 9 HIS A 51 ? ? -163.93 9.67 221 9 ASN A 57 ? ? -56.45 172.31 222 9 ALA A 59 ? ? -79.29 -71.51 223 9 PHE A 66 ? ? 54.79 80.62 224 9 LEU A 84 ? ? -40.43 156.04 225 9 PRO A 86 ? ? -50.12 -5.66 226 9 PRO A 100 ? ? -42.55 173.09 227 9 THR A 118 ? ? -45.66 -15.83 228 9 TYR A 130 ? ? 177.77 120.17 229 9 ASP A 131 ? ? -177.81 123.58 230 9 PRO A 134 ? ? -46.83 -7.99 231 9 ASP A 167 ? ? -74.87 30.14 232 9 GLN A 169 ? ? 40.95 15.88 233 9 ASN A 196 ? ? -68.93 -84.48 234 10 ALA A 3 ? ? -153.82 24.21 235 10 ARG A 10 ? ? 53.70 174.20 236 10 HIS A 11 ? ? -174.14 112.94 237 10 ASN A 24 ? ? 63.89 98.72 238 10 LYS A 30 ? ? -171.10 49.26 239 10 THR A 31 ? ? -46.35 157.66 240 10 GLN A 50 ? ? -104.94 74.94 241 10 HIS A 51 ? ? -164.59 22.42 242 10 ASN A 57 ? ? -59.04 -149.76 243 10 GLN A 58 ? ? -42.23 165.57 244 10 LYS A 60 ? ? -145.46 -77.94 245 10 GLN A 83 ? ? 76.60 41.13 246 10 LEU A 84 ? ? -46.88 154.62 247 10 ALA A 87 ? ? -40.87 -78.29 248 10 PRO A 100 ? ? -42.38 171.49 249 10 SER A 103 ? ? -39.09 -39.86 250 10 GLN A 115 ? ? -49.68 -16.21 251 10 THR A 118 ? ? -49.72 -11.80 252 10 TYR A 130 ? ? -150.99 37.10 253 10 PRO A 134 ? ? -51.42 -4.11 254 10 LEU A 135 ? ? -57.17 -4.40 255 10 ALA A 148 ? ? -41.83 151.32 256 10 ASP A 167 ? ? -76.08 33.24 257 10 GLN A 169 ? ? 39.93 17.90 258 10 GLN A 195 ? ? 73.46 -65.77 259 11 PRO A 5 ? ? -73.27 -86.78 260 11 ALA A 6 ? ? 67.05 175.39 261 11 ARG A 10 ? ? -162.30 -77.42 262 11 HIS A 11 ? ? -167.98 86.71 263 11 PRO A 15 ? ? -43.24 -17.10 264 11 ASN A 21 ? ? -55.98 -6.28 265 11 LYS A 30 ? ? -172.51 36.88 266 11 THR A 31 ? ? -47.49 162.39 267 11 HIS A 51 ? ? -170.42 -7.63 268 11 ASN A 57 ? ? -54.66 170.02 269 11 GLN A 58 ? ? 70.89 -173.27 270 11 ALA A 59 ? ? -177.94 10.60 271 11 LYS A 60 ? ? 74.04 -155.96 272 11 SER A 81 ? ? -52.57 -8.95 273 11 ALA A 87 ? ? -41.21 -94.63 274 11 PRO A 100 ? ? -42.20 171.02 275 11 CYS A 101 ? ? -108.05 -126.80 276 11 GLN A 115 ? ? -47.71 -18.06 277 11 THR A 118 ? ? -61.83 2.21 278 11 TYR A 130 ? ? -165.38 107.72 279 11 ASP A 131 ? ? -171.31 138.78 280 11 PRO A 134 ? ? -50.18 -4.26 281 11 LEU A 135 ? ? -49.99 -10.65 282 11 TRP A 162 ? ? -71.02 -70.68 283 11 ASP A 167 ? ? -76.12 34.55 284 11 GLN A 169 ? ? 41.93 16.25 285 11 LEU A 179 ? ? -39.38 -30.11 286 12 ALA A 6 ? ? 49.78 179.16 287 12 HIS A 11 ? ? 69.38 92.80 288 12 ASN A 23 ? ? -98.69 59.56 289 12 ASN A 24 ? ? 41.77 94.11 290 12 LYS A 30 ? ? -154.85 20.48 291 12 GLN A 50 ? ? -106.71 77.40 292 12 HIS A 51 ? ? -172.29 2.89 293 12 GLN A 58 ? ? 40.84 86.56 294 12 LYS A 60 ? ? -48.85 104.96 295 12 PHE A 66 ? ? 171.36 126.81 296 12 HIS A 70 ? ? -52.52 170.95 297 12 ALA A 87 ? ? -40.85 -77.95 298 12 ASN A 117 ? ? -104.30 41.59 299 12 THR A 118 ? ? -45.56 -13.42 300 12 HIS A 119 ? ? -76.24 20.37 301 12 TYR A 130 ? ? -164.64 119.77 302 12 ASP A 131 ? ? -179.77 133.89 303 12 PRO A 134 ? ? -49.11 -5.27 304 12 LEU A 135 ? ? -49.17 -11.56 305 12 TRP A 162 ? ? -66.86 -70.68 306 12 ASP A 167 ? ? -74.98 41.52 307 12 HIS A 168 ? ? -44.47 -15.75 308 12 GLN A 169 ? ? 42.78 15.38 309 12 PRO A 172 ? ? -47.96 162.17 310 12 GLN A 195 ? ? -66.35 5.71 311 13 ALA A 3 ? ? -99.44 36.00 312 13 SER A 4 ? ? -42.70 163.02 313 13 PRO A 5 ? ? -38.55 107.43 314 13 ARG A 10 ? ? -122.79 -109.35 315 13 ASN A 24 ? ? 42.05 -144.11 316 13 LYS A 30 ? ? -169.71 45.17 317 13 GLN A 50 ? ? -100.14 74.50 318 13 HIS A 51 ? ? -172.25 -5.46 319 13 ASN A 57 ? ? -51.09 173.17 320 13 GLN A 58 ? ? 58.75 160.09 321 13 ALA A 59 ? ? -169.44 -81.85 322 13 GLN A 83 ? ? 51.63 12.36 323 13 ALA A 87 ? ? -40.47 -71.16 324 13 PRO A 100 ? ? -42.32 171.21 325 13 GLN A 115 ? ? -46.86 -17.71 326 13 THR A 118 ? ? -59.61 -1.00 327 13 TRP A 162 ? ? -71.45 -70.48 328 13 ASP A 167 ? ? -71.95 41.33 329 13 GLN A 169 ? ? 44.72 14.54 330 13 LEU A 194 ? ? -69.52 3.56 331 13 GLN A 195 ? ? 52.40 89.23 332 13 GLN A 197 ? ? 62.47 142.15 333 14 ALA A 3 ? ? -43.89 155.09 334 14 SER A 4 ? ? -162.98 66.95 335 14 PRO A 5 ? ? -47.31 164.62 336 14 ALA A 6 ? ? -99.47 50.02 337 14 ASN A 24 ? ? -41.26 150.59 338 14 LYS A 30 ? ? -171.35 51.21 339 14 GLN A 50 ? ? -92.85 59.01 340 14 HIS A 51 ? ? -168.37 31.33 341 14 LYS A 60 ? ? 55.03 164.31 342 14 ASN A 61 ? ? -155.92 85.55 343 14 HIS A 70 ? ? -48.56 175.02 344 14 SER A 81 ? ? -56.89 -8.90 345 14 ALA A 87 ? ? -41.65 -75.46 346 14 CYS A 101 ? ? -107.13 -142.29 347 14 PHE A 102 ? ? -44.20 100.18 348 14 THR A 118 ? ? -48.14 -19.33 349 14 TYR A 132 ? ? -91.07 -61.06 350 14 PRO A 134 ? ? -69.97 19.51 351 14 TRP A 162 ? ? -68.86 -70.11 352 14 ASP A 167 ? ? -75.16 37.52 353 14 GLN A 169 ? ? 40.75 17.80 354 14 ASP A 177 ? ? -61.82 91.41 355 14 ARG A 191 ? ? -45.98 -18.82 356 14 GLN A 195 ? ? 64.37 -69.84 357 14 ASN A 196 ? ? 60.67 131.67 358 15 SER A 4 ? ? -155.12 61.01 359 15 PRO A 9 ? ? -48.11 167.92 360 15 PHE A 22 ? ? -96.20 35.11 361 15 ASN A 24 ? ? 58.72 118.28 362 15 LYS A 30 ? ? -170.60 44.99 363 15 THR A 31 ? ? -46.92 162.71 364 15 HIS A 51 ? ? -172.16 -6.96 365 15 GLN A 58 ? ? 44.37 -96.83 366 15 ALA A 59 ? ? 65.12 134.46 367 15 ASN A 61 ? ? -174.06 95.74 368 15 PHE A 66 ? ? 60.82 72.15 369 15 ALA A 87 ? ? -40.94 -75.25 370 15 PRO A 100 ? ? -42.44 170.81 371 15 SER A 103 ? ? -39.65 -38.73 372 15 THR A 118 ? ? -55.62 -4.28 373 15 TYR A 130 ? ? -152.49 26.95 374 15 ASP A 131 ? ? -51.58 -173.53 375 15 TYR A 132 ? ? -93.92 -65.80 376 15 PRO A 134 ? ? -70.56 27.73 377 15 ASP A 167 ? ? -74.52 36.63 378 15 GLN A 169 ? ? 38.25 24.65 379 15 ARG A 191 ? ? -45.51 -16.26 380 15 GLN A 195 ? ? -109.44 -147.29 381 15 ASN A 196 ? ? -165.29 67.06 382 15 GLN A 197 ? ? 50.02 -172.24 383 16 ALA A 6 ? ? -169.82 -11.90 384 16 SER A 7 ? ? 65.11 135.89 385 16 HIS A 11 ? ? -153.00 64.15 386 16 ARG A 28 ? ? -170.07 120.06 387 16 HIS A 29 ? ? -157.61 -88.35 388 16 LYS A 30 ? ? 179.81 121.76 389 16 HIS A 51 ? ? -172.10 -1.15 390 16 ALA A 59 ? ? -100.95 -93.71 391 16 ASN A 61 ? ? -162.83 113.06 392 16 PHE A 66 ? ? 65.80 70.26 393 16 ASP A 77 ? ? -43.02 -16.98 394 16 PRO A 80 ? ? -35.25 -39.78 395 16 ALA A 87 ? ? -41.61 -80.85 396 16 CYS A 101 ? ? -83.58 -150.38 397 16 PHE A 102 ? ? -34.16 104.92 398 16 SER A 103 ? ? -37.54 -23.89 399 16 GLN A 115 ? ? -46.87 -15.58 400 16 TYR A 130 ? ? -162.38 117.64 401 16 TYR A 132 ? ? -92.28 -63.11 402 16 PRO A 134 ? ? -69.87 29.32 403 16 TRP A 162 ? ? -70.41 -70.02 404 16 ASP A 167 ? ? -79.16 36.98 405 16 HIS A 168 ? ? -49.92 -10.61 406 16 GLN A 169 ? ? 52.73 7.97 407 16 GLN A 195 ? ? 55.37 -81.37 408 16 ASN A 196 ? ? -161.54 101.49 409 17 GLU A 2 ? ? 65.07 158.59 410 17 SER A 4 ? ? -170.88 61.34 411 17 SER A 7 ? ? -161.12 12.19 412 17 ARG A 10 ? ? -134.63 -109.76 413 17 HIS A 11 ? ? 69.43 101.19 414 17 ASN A 23 ? ? -56.77 101.61 415 17 ASN A 24 ? ? -41.86 150.33 416 17 ARG A 28 ? ? -172.05 127.33 417 17 HIS A 29 ? ? -163.55 -72.30 418 17 LYS A 30 ? ? 173.69 90.71 419 17 THR A 31 ? ? -46.66 150.93 420 17 HIS A 51 ? ? -173.15 -8.40 421 17 ASN A 57 ? ? -51.51 172.39 422 17 GLN A 58 ? ? 56.77 171.82 423 17 ALA A 59 ? ? 176.70 97.46 424 17 LYS A 60 ? ? 54.49 177.56 425 17 GLN A 83 ? ? 77.55 36.04 426 17 ALA A 87 ? ? -41.27 -79.66 427 17 CYS A 101 ? ? -106.31 -106.98 428 17 GLN A 115 ? ? -46.94 -19.99 429 17 THR A 118 ? ? -61.87 1.16 430 17 TYR A 130 ? ? -172.13 122.09 431 17 LEU A 135 ? ? -42.97 -19.87 432 17 ASP A 167 ? ? -69.63 37.10 433 17 GLN A 195 ? ? 66.98 -3.67 434 17 ASN A 196 ? ? 73.23 -53.63 435 18 SER A 4 ? ? -177.07 68.43 436 18 ALA A 6 ? ? -170.51 89.35 437 18 PRO A 9 ? ? -50.78 109.13 438 18 HIS A 11 ? ? 48.40 91.16 439 18 HIS A 29 ? ? -49.93 98.28 440 18 LYS A 30 ? ? -178.61 22.53 441 18 THR A 31 ? ? -46.63 162.69 442 18 GLN A 50 ? ? -117.17 78.23 443 18 HIS A 51 ? ? -169.93 30.98 444 18 ASN A 57 ? ? -47.61 176.93 445 18 ALA A 59 ? ? -65.97 99.77 446 18 LYS A 60 ? ? -136.62 -74.42 447 18 LEU A 62 ? ? -46.60 -10.89 448 18 LEU A 84 ? ? -41.46 155.64 449 18 PRO A 86 ? ? -51.30 -9.38 450 18 GLN A 88 ? ? -125.04 -167.64 451 18 PRO A 100 ? ? -42.35 153.84 452 18 CYS A 101 ? ? -96.66 -147.89 453 18 PHE A 102 ? ? -33.38 106.01 454 18 SER A 103 ? ? -37.48 -23.86 455 18 THR A 118 ? ? -49.86 -10.45 456 18 PRO A 134 ? ? -49.30 -6.66 457 18 LEU A 135 ? ? -47.76 -13.73 458 18 MET A 153 ? ? -50.36 102.19 459 18 ASP A 167 ? ? -75.25 30.97 460 18 GLN A 169 ? ? 42.53 14.27 461 18 ASP A 177 ? ? -43.64 96.78 462 18 GLN A 195 ? ? 54.05 105.52 463 19 ALA A 3 ? ? 177.31 81.60 464 19 SER A 4 ? ? -162.68 61.08 465 19 PRO A 9 ? ? -48.90 103.53 466 19 ARG A 10 ? ? -73.10 -169.26 467 19 ASN A 24 ? ? 46.73 -118.00 468 19 LYS A 30 ? ? -156.26 21.21 469 19 HIS A 51 ? ? -170.46 -2.55 470 19 ASN A 57 ? ? -63.41 -178.51 471 19 GLN A 58 ? ? 49.84 177.80 472 19 ALA A 59 ? ? -162.12 -141.38 473 19 ASN A 61 ? ? -104.96 79.88 474 19 PHE A 66 ? ? 40.29 29.51 475 19 LEU A 84 ? ? -40.01 156.34 476 19 PRO A 86 ? ? -48.78 -13.18 477 19 ALA A 87 ? ? -42.36 -74.06 478 19 PRO A 100 ? ? -42.16 171.50 479 19 CYS A 101 ? ? -132.44 -75.10 480 19 THR A 118 ? ? -59.32 -1.93 481 19 TYR A 130 ? ? -167.58 119.51 482 19 MET A 153 ? ? -41.60 108.82 483 19 ASP A 167 ? ? -75.05 33.02 484 19 GLN A 169 ? ? 39.03 19.59 485 19 GLN A 195 ? ? 64.00 -68.54 486 19 ASN A 196 ? ? 55.97 107.59 487 19 GLN A 197 ? ? -56.10 -74.76 488 20 GLU A 2 ? ? 55.51 107.91 489 20 ALA A 6 ? ? -149.51 -85.79 490 20 SER A 7 ? ? 63.02 179.34 491 20 ARG A 10 ? ? 54.98 107.59 492 20 HIS A 11 ? ? -167.31 73.94 493 20 ARG A 28 ? ? -172.90 120.27 494 20 HIS A 29 ? ? -176.41 -89.03 495 20 LYS A 30 ? ? -175.17 102.14 496 20 THR A 31 ? ? -46.56 159.94 497 20 HIS A 51 ? ? -173.41 14.20 498 20 ASN A 57 ? ? -48.71 154.51 499 20 GLN A 58 ? ? 35.90 -157.56 500 20 LYS A 60 ? ? -65.65 77.04 501 20 ASN A 61 ? ? -150.60 82.40 502 20 LEU A 62 ? ? -68.28 7.97 503 20 PHE A 66 ? ? 58.44 120.22 504 20 ALA A 87 ? ? -41.57 -93.92 505 20 GLN A 88 ? ? -104.73 -168.91 506 20 PRO A 100 ? ? -42.11 170.84 507 20 ASN A 117 ? ? -166.53 35.32 508 20 THR A 118 ? ? -51.48 -5.96 509 20 ASP A 131 ? ? -177.61 138.30 510 20 PRO A 134 ? ? -49.90 -5.35 511 20 LEU A 135 ? ? -46.84 -14.22 512 20 ALA A 148 ? ? -47.59 164.41 513 20 ASP A 167 ? ? -75.50 29.22 514 20 GLN A 169 ? ? 40.12 18.62 515 20 GLN A 195 ? ? -133.44 -99.78 516 20 ASN A 196 ? ? -163.24 -56.90 517 20 GLN A 197 ? ? -141.59 -62.42 518 21 GLU A 2 ? ? 49.65 -87.98 519 21 ALA A 3 ? ? 66.60 110.98 520 21 ALA A 6 ? ? 78.09 -38.47 521 21 SER A 7 ? ? 59.16 103.62 522 21 HIS A 11 ? ? -156.94 68.17 523 21 ASN A 23 ? ? -77.86 -119.56 524 21 ILE A 26 ? ? -103.20 -165.95 525 21 HIS A 29 ? ? -157.29 -30.35 526 21 LYS A 30 ? ? 168.23 77.35 527 21 THR A 31 ? ? -44.52 162.29 528 21 GLN A 50 ? ? -108.44 71.07 529 21 HIS A 51 ? ? -163.66 14.39 530 21 GLN A 58 ? ? 48.94 101.33 531 21 LYS A 60 ? ? 56.47 9.35 532 21 ASN A 61 ? ? -93.87 50.31 533 21 PHE A 66 ? ? -100.87 76.55 534 21 SER A 81 ? ? -57.10 -8.98 535 21 ALA A 87 ? ? -40.56 -70.61 536 21 CYS A 101 ? ? -96.58 -145.81 537 21 PHE A 102 ? ? -40.96 103.57 538 21 SER A 103 ? ? -38.86 -24.63 539 21 GLN A 115 ? ? -47.99 -15.17 540 21 THR A 118 ? ? -67.65 2.57 541 21 TRP A 162 ? ? -72.56 -70.52 542 21 ASP A 167 ? ? -74.69 29.71 543 21 GLN A 169 ? ? 42.72 14.65 544 21 ASP A 177 ? ? -52.96 102.90 545 21 GLN A 195 ? ? 49.22 91.99 546 21 ASN A 196 ? ? 60.47 164.37 547 21 GLN A 197 ? ? -56.58 -74.09 548 22 GLU A 2 ? ? 54.38 -91.16 549 22 ALA A 3 ? ? 72.52 -66.62 550 22 SER A 4 ? ? 42.72 70.84 551 22 PRO A 5 ? ? -51.01 -8.92 552 22 SER A 7 ? ? -163.84 91.33 553 22 PRO A 9 ? ? -75.03 -163.70 554 22 ARG A 10 ? ? 65.41 -179.45 555 22 HIS A 11 ? ? -156.05 83.35 556 22 ASN A 23 ? ? -59.79 -123.31 557 22 LYS A 30 ? ? -165.77 50.51 558 22 THR A 31 ? ? -46.97 153.82 559 22 HIS A 51 ? ? -168.51 -5.61 560 22 GLN A 58 ? ? 74.81 -59.74 561 22 ALA A 59 ? ? 56.68 166.43 562 22 LYS A 60 ? ? -75.86 -144.66 563 22 LEU A 84 ? ? -41.81 156.08 564 22 PRO A 86 ? ? -48.07 -13.93 565 22 PRO A 100 ? ? -56.00 172.86 566 22 CYS A 101 ? ? -120.97 -74.06 567 22 THR A 118 ? ? -45.71 -13.78 568 22 ASP A 131 ? ? -174.64 131.72 569 22 PRO A 134 ? ? -50.43 -1.27 570 22 LEU A 135 ? ? -69.48 4.66 571 22 ASP A 145 ? ? -63.22 2.28 572 22 ALA A 148 ? ? -46.92 157.67 573 22 ASP A 167 ? ? -69.85 65.99 574 22 HIS A 168 ? ? -56.23 -8.23 575 22 GLN A 169 ? ? 40.20 22.13 576 22 PRO A 172 ? ? -47.95 164.28 577 22 GLN A 197 ? ? 59.74 2.31 578 23 SER A 4 ? ? 61.22 60.47 579 23 ALA A 6 ? ? -102.66 -165.79 580 23 SER A 7 ? ? -136.88 -148.43 581 23 ARG A 10 ? ? -161.02 96.96 582 23 HIS A 11 ? ? 46.93 86.02 583 23 ASN A 24 ? ? 63.88 128.25 584 23 LYS A 30 ? ? -173.09 52.82 585 23 THR A 31 ? ? -46.85 162.72 586 23 HIS A 51 ? ? -170.27 25.89 587 23 ASN A 57 ? ? -45.07 171.34 588 23 ALA A 59 ? ? -82.59 -144.51 589 23 ASN A 61 ? ? -174.94 108.26 590 23 PHE A 66 ? ? 53.26 85.50 591 23 ALA A 71 ? ? -47.30 -15.11 592 23 LEU A 84 ? ? -41.27 154.88 593 23 PRO A 86 ? ? -49.84 -7.88 594 23 PRO A 100 ? ? -42.08 163.70 595 23 ASN A 117 ? ? -153.65 46.56 596 23 TYR A 132 ? ? -104.90 -63.01 597 23 PRO A 134 ? ? -69.92 21.18 598 23 TRP A 162 ? ? -71.69 -70.51 599 23 ASP A 167 ? ? -73.94 38.66 600 23 HIS A 168 ? ? -47.69 -13.62 601 23 GLN A 169 ? ? 46.01 12.69 602 23 PRO A 172 ? ? -47.96 154.02 603 23 LEU A 194 ? ? -69.65 9.73 604 24 GLU A 2 ? ? -96.71 -72.29 605 24 ALA A 3 ? ? 47.21 -98.68 606 24 ALA A 6 ? ? -53.49 99.85 607 24 SER A 7 ? ? -102.07 69.01 608 24 PRO A 9 ? ? -45.78 96.89 609 24 HIS A 11 ? ? -162.26 76.65 610 24 PHE A 22 ? ? -98.96 31.13 611 24 ASN A 24 ? ? 42.21 -137.79 612 24 HIS A 29 ? ? -71.65 44.08 613 24 LYS A 30 ? ? -71.46 41.78 614 24 HIS A 51 ? ? -163.88 14.71 615 24 GLN A 58 ? ? 65.61 147.81 616 24 ALA A 59 ? ? -163.84 52.92 617 24 LYS A 60 ? ? 43.89 -97.99 618 24 ASN A 61 ? ? 40.97 25.54 619 24 PRO A 80 ? ? -49.75 -17.07 620 24 LEU A 84 ? ? -38.66 107.23 621 24 ASP A 85 ? ? -41.61 105.28 622 24 PRO A 86 ? ? -48.11 -19.97 623 24 ALA A 87 ? ? -46.55 -88.73 624 24 CYS A 101 ? ? -103.49 -153.98 625 24 PHE A 102 ? ? -36.88 113.02 626 24 THR A 118 ? ? -60.95 4.87 627 24 ASP A 131 ? ? -152.92 -147.05 628 24 TYR A 132 ? ? -106.80 -64.38 629 24 LEU A 135 ? ? -53.97 -7.41 630 24 TRP A 162 ? ? -72.09 -70.15 631 24 ASP A 167 ? ? -76.78 34.79 632 24 GLN A 169 ? ? 40.58 21.83 633 24 PRO A 172 ? ? -51.83 172.33 634 24 ASN A 196 ? ? 51.87 101.84 635 24 GLN A 197 ? ? 41.70 79.62 636 25 GLU A 2 ? ? 46.36 89.26 637 25 ALA A 3 ? ? -139.36 -37.01 638 25 PRO A 5 ? ? -58.56 -169.09 639 25 ALA A 6 ? ? 60.90 121.83 640 25 SER A 7 ? ? -138.88 -60.30 641 25 HIS A 11 ? ? -163.87 91.20 642 25 ASN A 23 ? ? -56.64 108.17 643 25 LYS A 30 ? ? -167.03 42.53 644 25 THR A 31 ? ? -46.50 150.97 645 25 HIS A 51 ? ? -169.18 46.39 646 25 ASN A 57 ? ? -78.27 -166.76 647 25 GLN A 58 ? ? 78.90 -62.81 648 25 ALA A 59 ? ? 70.09 -163.80 649 25 PHE A 66 ? ? -143.70 18.78 650 25 PRO A 100 ? ? -42.45 172.24 651 25 CYS A 101 ? ? -126.08 -50.95 652 25 ASN A 117 ? ? -148.22 31.10 653 25 ASP A 131 ? ? -172.36 142.30 654 25 PRO A 134 ? ? -51.45 -4.76 655 25 ASP A 167 ? ? -70.21 41.97 656 25 HIS A 168 ? ? -54.12 -8.17 657 25 GLN A 169 ? ? 56.90 3.64 658 25 ASP A 177 ? ? -49.59 91.47 659 25 GLN A 195 ? ? 62.12 -71.47 660 26 ALA A 3 ? ? 53.00 97.41 661 26 ALA A 6 ? ? -175.42 -15.94 662 26 SER A 7 ? ? 57.01 -145.70 663 26 ARG A 10 ? ? -96.83 -117.52 664 26 HIS A 11 ? ? -152.28 34.33 665 26 HIS A 29 ? ? -56.58 82.09 666 26 LYS A 30 ? ? -157.10 26.90 667 26 GLN A 50 ? ? -103.10 76.33 668 26 HIS A 51 ? ? -171.52 -3.63 669 26 ASN A 57 ? ? -40.30 151.51 670 26 LYS A 60 ? ? -108.84 -66.00 671 26 PHE A 66 ? ? -168.10 34.46 672 26 GLN A 83 ? ? 73.76 35.73 673 26 ALA A 87 ? ? -41.01 -74.48 674 26 CYS A 101 ? ? -79.79 -164.04 675 26 PHE A 102 ? ? -40.24 91.91 676 26 SER A 103 ? ? -39.42 -23.87 677 26 THR A 118 ? ? -62.18 1.93 678 26 PRO A 134 ? ? -49.82 77.38 679 26 MET A 153 ? ? -44.20 151.30 680 26 TRP A 162 ? ? -71.76 -70.42 681 26 ASP A 167 ? ? -73.27 35.48 682 26 GLN A 169 ? ? 42.67 15.80 683 26 ASP A 177 ? ? -57.84 91.01 684 26 ASN A 196 ? ? 57.50 163.91 685 27 SER A 4 ? ? 55.85 162.83 686 27 PRO A 5 ? ? -70.77 -166.18 687 27 ARG A 28 ? ? -176.36 120.22 688 27 HIS A 29 ? ? -164.47 -82.55 689 27 LYS A 30 ? ? -179.74 104.63 690 27 HIS A 51 ? ? -170.29 -9.19 691 27 GLN A 58 ? ? 76.65 -64.79 692 27 ALA A 59 ? ? 53.30 173.95 693 27 LYS A 60 ? ? -103.63 68.89 694 27 GLN A 83 ? ? 72.36 47.50 695 27 PRO A 100 ? ? -43.27 173.06 696 27 CYS A 101 ? ? -107.04 -119.41 697 27 GLN A 115 ? ? -46.74 -17.82 698 27 THR A 118 ? ? -60.35 1.55 699 27 TYR A 130 ? ? 177.77 116.66 700 27 ASP A 131 ? ? -177.94 136.32 701 27 PRO A 134 ? ? -49.47 -6.69 702 27 LEU A 135 ? ? -54.90 -5.35 703 27 ASP A 167 ? ? -71.85 39.54 704 27 GLN A 195 ? ? 55.95 97.60 705 27 GLN A 197 ? ? -164.45 -52.28 706 28 ALA A 3 ? ? -140.01 26.85 707 28 SER A 4 ? ? 55.80 162.72 708 28 ALA A 6 ? ? 47.70 -176.95 709 28 PRO A 9 ? ? -45.79 101.81 710 28 ARG A 10 ? ? -143.48 -69.96 711 28 HIS A 11 ? ? 69.93 121.71 712 28 ASN A 24 ? ? -40.48 93.73 713 28 HIS A 29 ? ? -66.62 79.59 714 28 LYS A 30 ? ? -163.33 39.56 715 28 THR A 31 ? ? -47.02 157.81 716 28 HIS A 51 ? ? -171.17 13.20 717 28 ALA A 59 ? ? -139.71 -99.57 718 28 LEU A 62 ? ? -66.35 0.84 719 28 PHE A 66 ? ? 77.26 -38.64 720 28 TYR A 67 ? ? -42.11 157.27 721 28 GLN A 83 ? ? 80.61 45.26 722 28 LEU A 84 ? ? -38.08 155.80 723 28 PRO A 86 ? ? -46.88 -8.71 724 28 CYS A 101 ? ? -86.43 -83.36 725 28 GLN A 115 ? ? -46.55 -17.60 726 28 THR A 118 ? ? -45.65 -16.94 727 28 TYR A 132 ? ? -90.56 -66.04 728 28 PRO A 134 ? ? -69.80 25.16 729 28 TRP A 162 ? ? -74.24 -70.55 730 28 ASP A 167 ? ? -75.97 37.91 731 28 GLN A 169 ? ? 40.47 18.89 732 28 ASP A 177 ? ? -53.38 87.49 733 28 ASN A 196 ? ? -93.47 -62.89 734 29 ALA A 3 ? ? -172.51 -169.38 735 29 ALA A 6 ? ? 49.38 -158.16 736 29 SER A 7 ? ? -141.38 -158.76 737 29 ARG A 10 ? ? -116.55 -80.02 738 29 ASN A 21 ? ? -69.03 0.36 739 29 ASN A 24 ? ? -42.24 165.99 740 29 LYS A 30 ? ? -171.58 48.74 741 29 THR A 31 ? ? -46.98 162.95 742 29 HIS A 51 ? ? -173.76 -13.56 743 29 GLN A 58 ? ? 49.72 76.33 744 29 LYS A 60 ? ? 53.48 101.56 745 29 LEU A 62 ? ? -68.22 6.98 746 29 PHE A 66 ? ? 164.47 109.74 747 29 LEU A 84 ? ? -47.38 155.95 748 29 PRO A 86 ? ? -48.55 -8.02 749 29 PRO A 100 ? ? -43.43 173.15 750 29 CYS A 101 ? ? -112.39 -147.20 751 29 PHE A 102 ? ? -41.76 100.04 752 29 SER A 103 ? ? -39.10 -23.98 753 29 ASN A 117 ? ? -157.09 29.32 754 29 THR A 118 ? ? -47.07 -10.05 755 29 TYR A 130 ? ? -97.18 -140.43 756 29 ASP A 131 ? ? -163.93 21.78 757 29 PRO A 134 ? ? -50.68 -6.74 758 29 ALA A 148 ? ? -66.25 -176.69 759 29 ASP A 167 ? ? -70.86 37.43 760 29 HIS A 168 ? ? -48.29 -13.61 761 29 GLN A 169 ? ? 41.64 19.40 762 29 GLN A 197 ? ? -80.47 -158.21 763 30 ALA A 3 ? ? -153.09 18.09 764 30 PRO A 5 ? ? -47.53 155.62 765 30 ALA A 6 ? ? -164.28 -93.74 766 30 SER A 7 ? ? 68.37 149.55 767 30 ASN A 24 ? ? 61.92 130.11 768 30 ILE A 26 ? ? -78.47 -165.04 769 30 HIS A 29 ? ? -175.49 -82.34 770 30 LYS A 30 ? ? -173.48 108.74 771 30 GLN A 50 ? ? -102.31 76.58 772 30 HIS A 51 ? ? -172.94 -10.47 773 30 ASN A 57 ? ? -79.16 -167.86 774 30 GLN A 58 ? ? 54.60 -84.56 775 30 ALA A 59 ? ? 77.31 -149.59 776 30 ASN A 61 ? ? -103.14 48.11 777 30 LEU A 84 ? ? -35.96 155.99 778 30 PRO A 86 ? ? -45.26 -10.53 779 30 PRO A 100 ? ? -42.49 173.04 780 30 CYS A 101 ? ? -131.26 -54.95 781 30 GLN A 115 ? ? -46.57 -19.41 782 30 ASN A 117 ? ? -141.70 55.19 783 30 THR A 118 ? ? -53.81 -9.29 784 30 PRO A 134 ? ? -69.22 7.81 785 30 TRP A 162 ? ? -73.87 -71.20 786 30 ASP A 167 ? ? -71.35 36.19 787 30 GLN A 169 ? ? 42.88 15.30 788 30 ARG A 191 ? ? -46.55 -16.29 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 200 ? A LEU 200 2 1 Y 1 A GLU 201 ? A GLU 201 3 1 Y 1 A HIS 202 ? A HIS 202 4 1 Y 1 A HIS 203 ? A HIS 203 5 1 Y 1 A HIS 204 ? A HIS 204 6 1 Y 1 A HIS 205 ? A HIS 205 7 1 Y 1 A HIS 206 ? A HIS 206 8 1 Y 1 A HIS 207 ? A HIS 207 9 2 Y 1 A LEU 200 ? A LEU 200 10 2 Y 1 A GLU 201 ? A GLU 201 11 2 Y 1 A HIS 202 ? A HIS 202 12 2 Y 1 A HIS 203 ? A HIS 203 13 2 Y 1 A HIS 204 ? A HIS 204 14 2 Y 1 A HIS 205 ? A HIS 205 15 2 Y 1 A HIS 206 ? A HIS 206 16 2 Y 1 A HIS 207 ? A HIS 207 17 3 Y 1 A LEU 200 ? A LEU 200 18 3 Y 1 A GLU 201 ? A GLU 201 19 3 Y 1 A HIS 202 ? A HIS 202 20 3 Y 1 A HIS 203 ? A HIS 203 21 3 Y 1 A HIS 204 ? A HIS 204 22 3 Y 1 A HIS 205 ? A HIS 205 23 3 Y 1 A HIS 206 ? A HIS 206 24 3 Y 1 A HIS 207 ? A HIS 207 25 4 Y 1 A LEU 200 ? A LEU 200 26 4 Y 1 A GLU 201 ? A GLU 201 27 4 Y 1 A HIS 202 ? A HIS 202 28 4 Y 1 A HIS 203 ? A HIS 203 29 4 Y 1 A HIS 204 ? A HIS 204 30 4 Y 1 A HIS 205 ? A HIS 205 31 4 Y 1 A HIS 206 ? A HIS 206 32 4 Y 1 A HIS 207 ? A HIS 207 33 5 Y 1 A LEU 200 ? A LEU 200 34 5 Y 1 A GLU 201 ? A GLU 201 35 5 Y 1 A HIS 202 ? A HIS 202 36 5 Y 1 A HIS 203 ? A HIS 203 37 5 Y 1 A HIS 204 ? A HIS 204 38 5 Y 1 A HIS 205 ? A HIS 205 39 5 Y 1 A HIS 206 ? A HIS 206 40 5 Y 1 A HIS 207 ? A HIS 207 41 6 Y 1 A LEU 200 ? A LEU 200 42 6 Y 1 A GLU 201 ? A GLU 201 43 6 Y 1 A HIS 202 ? A HIS 202 44 6 Y 1 A HIS 203 ? A HIS 203 45 6 Y 1 A HIS 204 ? A HIS 204 46 6 Y 1 A HIS 205 ? A HIS 205 47 6 Y 1 A HIS 206 ? A HIS 206 48 6 Y 1 A HIS 207 ? A HIS 207 49 7 Y 1 A LEU 200 ? A LEU 200 50 7 Y 1 A GLU 201 ? A GLU 201 51 7 Y 1 A HIS 202 ? A HIS 202 52 7 Y 1 A HIS 203 ? A HIS 203 53 7 Y 1 A HIS 204 ? A HIS 204 54 7 Y 1 A HIS 205 ? A HIS 205 55 7 Y 1 A HIS 206 ? A HIS 206 56 7 Y 1 A HIS 207 ? A HIS 207 57 8 Y 1 A LEU 200 ? A LEU 200 58 8 Y 1 A GLU 201 ? A GLU 201 59 8 Y 1 A HIS 202 ? A HIS 202 60 8 Y 1 A HIS 203 ? A HIS 203 61 8 Y 1 A HIS 204 ? A HIS 204 62 8 Y 1 A HIS 205 ? A HIS 205 63 8 Y 1 A HIS 206 ? A HIS 206 64 8 Y 1 A HIS 207 ? A HIS 207 65 9 Y 1 A LEU 200 ? A LEU 200 66 9 Y 1 A GLU 201 ? A GLU 201 67 9 Y 1 A HIS 202 ? A HIS 202 68 9 Y 1 A HIS 203 ? A HIS 203 69 9 Y 1 A HIS 204 ? A HIS 204 70 9 Y 1 A HIS 205 ? A HIS 205 71 9 Y 1 A HIS 206 ? A HIS 206 72 9 Y 1 A HIS 207 ? A HIS 207 73 10 Y 1 A LEU 200 ? A LEU 200 74 10 Y 1 A GLU 201 ? A GLU 201 75 10 Y 1 A HIS 202 ? A HIS 202 76 10 Y 1 A HIS 203 ? A HIS 203 77 10 Y 1 A HIS 204 ? A HIS 204 78 10 Y 1 A HIS 205 ? A HIS 205 79 10 Y 1 A HIS 206 ? A HIS 206 80 10 Y 1 A HIS 207 ? A HIS 207 81 11 Y 1 A LEU 200 ? A LEU 200 82 11 Y 1 A GLU 201 ? A GLU 201 83 11 Y 1 A HIS 202 ? A HIS 202 84 11 Y 1 A HIS 203 ? A HIS 203 85 11 Y 1 A HIS 204 ? A HIS 204 86 11 Y 1 A HIS 205 ? A HIS 205 87 11 Y 1 A HIS 206 ? A HIS 206 88 11 Y 1 A HIS 207 ? A HIS 207 89 12 Y 1 A LEU 200 ? A LEU 200 90 12 Y 1 A GLU 201 ? A GLU 201 91 12 Y 1 A HIS 202 ? A HIS 202 92 12 Y 1 A HIS 203 ? A HIS 203 93 12 Y 1 A HIS 204 ? A HIS 204 94 12 Y 1 A HIS 205 ? A HIS 205 95 12 Y 1 A HIS 206 ? A HIS 206 96 12 Y 1 A HIS 207 ? A HIS 207 97 13 Y 1 A LEU 200 ? A LEU 200 98 13 Y 1 A GLU 201 ? A GLU 201 99 13 Y 1 A HIS 202 ? A HIS 202 100 13 Y 1 A HIS 203 ? A HIS 203 101 13 Y 1 A HIS 204 ? A HIS 204 102 13 Y 1 A HIS 205 ? A HIS 205 103 13 Y 1 A HIS 206 ? A HIS 206 104 13 Y 1 A HIS 207 ? A HIS 207 105 14 Y 1 A LEU 200 ? A LEU 200 106 14 Y 1 A GLU 201 ? A GLU 201 107 14 Y 1 A HIS 202 ? A HIS 202 108 14 Y 1 A HIS 203 ? A HIS 203 109 14 Y 1 A HIS 204 ? A HIS 204 110 14 Y 1 A HIS 205 ? A HIS 205 111 14 Y 1 A HIS 206 ? A HIS 206 112 14 Y 1 A HIS 207 ? A HIS 207 113 15 Y 1 A LEU 200 ? A LEU 200 114 15 Y 1 A GLU 201 ? A GLU 201 115 15 Y 1 A HIS 202 ? A HIS 202 116 15 Y 1 A HIS 203 ? A HIS 203 117 15 Y 1 A HIS 204 ? A HIS 204 118 15 Y 1 A HIS 205 ? A HIS 205 119 15 Y 1 A HIS 206 ? A HIS 206 120 15 Y 1 A HIS 207 ? A HIS 207 121 16 Y 1 A LEU 200 ? A LEU 200 122 16 Y 1 A GLU 201 ? A GLU 201 123 16 Y 1 A HIS 202 ? A HIS 202 124 16 Y 1 A HIS 203 ? A HIS 203 125 16 Y 1 A HIS 204 ? A HIS 204 126 16 Y 1 A HIS 205 ? A HIS 205 127 16 Y 1 A HIS 206 ? A HIS 206 128 16 Y 1 A HIS 207 ? A HIS 207 129 17 Y 1 A LEU 200 ? A LEU 200 130 17 Y 1 A GLU 201 ? A GLU 201 131 17 Y 1 A HIS 202 ? A HIS 202 132 17 Y 1 A HIS 203 ? A HIS 203 133 17 Y 1 A HIS 204 ? A HIS 204 134 17 Y 1 A HIS 205 ? A HIS 205 135 17 Y 1 A HIS 206 ? A HIS 206 136 17 Y 1 A HIS 207 ? A HIS 207 137 18 Y 1 A LEU 200 ? A LEU 200 138 18 Y 1 A GLU 201 ? A GLU 201 139 18 Y 1 A HIS 202 ? A HIS 202 140 18 Y 1 A HIS 203 ? A HIS 203 141 18 Y 1 A HIS 204 ? A HIS 204 142 18 Y 1 A HIS 205 ? A HIS 205 143 18 Y 1 A HIS 206 ? A HIS 206 144 18 Y 1 A HIS 207 ? A HIS 207 145 19 Y 1 A LEU 200 ? A LEU 200 146 19 Y 1 A GLU 201 ? A GLU 201 147 19 Y 1 A HIS 202 ? A HIS 202 148 19 Y 1 A HIS 203 ? A HIS 203 149 19 Y 1 A HIS 204 ? A HIS 204 150 19 Y 1 A HIS 205 ? A HIS 205 151 19 Y 1 A HIS 206 ? A HIS 206 152 19 Y 1 A HIS 207 ? A HIS 207 153 20 Y 1 A LEU 200 ? A LEU 200 154 20 Y 1 A GLU 201 ? A GLU 201 155 20 Y 1 A HIS 202 ? A HIS 202 156 20 Y 1 A HIS 203 ? A HIS 203 157 20 Y 1 A HIS 204 ? A HIS 204 158 20 Y 1 A HIS 205 ? A HIS 205 159 20 Y 1 A HIS 206 ? A HIS 206 160 20 Y 1 A HIS 207 ? A HIS 207 161 21 Y 1 A LEU 200 ? A LEU 200 162 21 Y 1 A GLU 201 ? A GLU 201 163 21 Y 1 A HIS 202 ? A HIS 202 164 21 Y 1 A HIS 203 ? A HIS 203 165 21 Y 1 A HIS 204 ? A HIS 204 166 21 Y 1 A HIS 205 ? A HIS 205 167 21 Y 1 A HIS 206 ? A HIS 206 168 21 Y 1 A HIS 207 ? A HIS 207 169 22 Y 1 A LEU 200 ? A LEU 200 170 22 Y 1 A GLU 201 ? A GLU 201 171 22 Y 1 A HIS 202 ? A HIS 202 172 22 Y 1 A HIS 203 ? A HIS 203 173 22 Y 1 A HIS 204 ? A HIS 204 174 22 Y 1 A HIS 205 ? A HIS 205 175 22 Y 1 A HIS 206 ? A HIS 206 176 22 Y 1 A HIS 207 ? A HIS 207 177 23 Y 1 A LEU 200 ? A LEU 200 178 23 Y 1 A GLU 201 ? A GLU 201 179 23 Y 1 A HIS 202 ? A HIS 202 180 23 Y 1 A HIS 203 ? A HIS 203 181 23 Y 1 A HIS 204 ? A HIS 204 182 23 Y 1 A HIS 205 ? A HIS 205 183 23 Y 1 A HIS 206 ? A HIS 206 184 23 Y 1 A HIS 207 ? A HIS 207 185 24 Y 1 A LEU 200 ? A LEU 200 186 24 Y 1 A GLU 201 ? A GLU 201 187 24 Y 1 A HIS 202 ? A HIS 202 188 24 Y 1 A HIS 203 ? A HIS 203 189 24 Y 1 A HIS 204 ? A HIS 204 190 24 Y 1 A HIS 205 ? A HIS 205 191 24 Y 1 A HIS 206 ? A HIS 206 192 24 Y 1 A HIS 207 ? A HIS 207 193 25 Y 1 A LEU 200 ? A LEU 200 194 25 Y 1 A GLU 201 ? A GLU 201 195 25 Y 1 A HIS 202 ? A HIS 202 196 25 Y 1 A HIS 203 ? A HIS 203 197 25 Y 1 A HIS 204 ? A HIS 204 198 25 Y 1 A HIS 205 ? A HIS 205 199 25 Y 1 A HIS 206 ? A HIS 206 200 25 Y 1 A HIS 207 ? A HIS 207 201 26 Y 1 A LEU 200 ? A LEU 200 202 26 Y 1 A GLU 201 ? A GLU 201 203 26 Y 1 A HIS 202 ? A HIS 202 204 26 Y 1 A HIS 203 ? A HIS 203 205 26 Y 1 A HIS 204 ? A HIS 204 206 26 Y 1 A HIS 205 ? A HIS 205 207 26 Y 1 A HIS 206 ? A HIS 206 208 26 Y 1 A HIS 207 ? A HIS 207 209 27 Y 1 A LEU 200 ? A LEU 200 210 27 Y 1 A GLU 201 ? A GLU 201 211 27 Y 1 A HIS 202 ? A HIS 202 212 27 Y 1 A HIS 203 ? A HIS 203 213 27 Y 1 A HIS 204 ? A HIS 204 214 27 Y 1 A HIS 205 ? A HIS 205 215 27 Y 1 A HIS 206 ? A HIS 206 216 27 Y 1 A HIS 207 ? A HIS 207 217 28 Y 1 A LEU 200 ? A LEU 200 218 28 Y 1 A GLU 201 ? A GLU 201 219 28 Y 1 A HIS 202 ? A HIS 202 220 28 Y 1 A HIS 203 ? A HIS 203 221 28 Y 1 A HIS 204 ? A HIS 204 222 28 Y 1 A HIS 205 ? A HIS 205 223 28 Y 1 A HIS 206 ? A HIS 206 224 28 Y 1 A HIS 207 ? A HIS 207 225 29 Y 1 A LEU 200 ? A LEU 200 226 29 Y 1 A GLU 201 ? A GLU 201 227 29 Y 1 A HIS 202 ? A HIS 202 228 29 Y 1 A HIS 203 ? A HIS 203 229 29 Y 1 A HIS 204 ? A HIS 204 230 29 Y 1 A HIS 205 ? A HIS 205 231 29 Y 1 A HIS 206 ? A HIS 206 232 29 Y 1 A HIS 207 ? A HIS 207 233 30 Y 1 A LEU 200 ? A LEU 200 234 30 Y 1 A GLU 201 ? A GLU 201 235 30 Y 1 A HIS 202 ? A HIS 202 236 30 Y 1 A HIS 203 ? A HIS 203 237 30 Y 1 A HIS 204 ? A HIS 204 238 30 Y 1 A HIS 205 ? A HIS 205 239 30 Y 1 A HIS 206 ? A HIS 206 240 30 Y 1 A HIS 207 ? A HIS 207 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #