data_2M6N # _entry.id 2M6N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M6N RCSB RCSB103275 BMRB 19147 WWPDB D_1000103275 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2CT7 PDB . unspecified 2JMO PDB . unspecified 19147 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M6N _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Frye, J.J.' 1 'Brown, N.G.' 2 'Petzold, G.' 3 'Watson, E.R.' 4 'Royappa, G.R.' 5 'Nourse, A.' 6 'Jarvis, M.' 7 'Kriwacki, R.W.' 8 'Peters, J.' 9 'Stark, H.' 10 'Schulman, B.A.' 11 # _citation.id primary _citation.title 'Electron microscopy structure of human APC/C(CDH1)-EMI1 reveals multimodal mechanism of E3 ligase shutdown.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 20 _citation.page_first 827 _citation.page_last 835 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23708605 _citation.pdbx_database_id_DOI 10.1038/nsmb.2593 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Frye, J.J.' 1 primary 'Brown, N.G.' 2 primary 'Petzold, G.' 3 primary 'Watson, E.R.' 4 primary 'Grace, C.R.' 5 primary 'Nourse, A.' 6 primary 'Jarvis, M.A.' 7 primary 'Kriwacki, R.W.' 8 primary 'Peters, J.M.' 9 primary 'Stark, H.' 10 primary 'Schulman, B.A.' 11 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'F-box only protein 5' 9605.360 1 ? ? 'zinc binding domain (UNP residues 364-447)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EMI1, Early mitotic inhibitor 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSK KNLRRL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSK KNLRRL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 VAL n 1 5 ALA n 1 6 LYS n 1 7 THR n 1 8 LEU n 1 9 LYS n 1 10 LYS n 1 11 ASN n 1 12 GLU n 1 13 SER n 1 14 LEU n 1 15 LYS n 1 16 ALA n 1 17 CYS n 1 18 ILE n 1 19 ARG n 1 20 CYS n 1 21 ASN n 1 22 SER n 1 23 PRO n 1 24 ALA n 1 25 LYS n 1 26 TYR n 1 27 ASP n 1 28 CYS n 1 29 TYR n 1 30 LEU n 1 31 GLN n 1 32 ARG n 1 33 ALA n 1 34 THR n 1 35 CYS n 1 36 LYS n 1 37 ARG n 1 38 GLU n 1 39 GLY n 1 40 CYS n 1 41 GLY n 1 42 PHE n 1 43 ASP n 1 44 TYR n 1 45 CYS n 1 46 THR n 1 47 LYS n 1 48 CYS n 1 49 LEU n 1 50 CYS n 1 51 ASN n 1 52 TYR n 1 53 HIS n 1 54 THR n 1 55 THR n 1 56 LYS n 1 57 ASP n 1 58 CYS n 1 59 SER n 1 60 ASP n 1 61 GLY n 1 62 LYS n 1 63 LEU n 1 64 LEU n 1 65 LYS n 1 66 ALA n 1 67 SER n 1 68 CYS n 1 69 LYS n 1 70 ILE n 1 71 GLY n 1 72 PRO n 1 73 LEU n 1 74 PRO n 1 75 GLY n 1 76 THR n 1 77 LYS n 1 78 LYS n 1 79 SER n 1 80 LYS n 1 81 LYS n 1 82 ASN n 1 83 LEU n 1 84 ARG n 1 85 ARG n 1 86 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FBXO5, EMI1, FBX5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX4T1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FBX5_HUMAN _struct_ref.pdbx_db_accession Q9UKT4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKN LRRL ; _struct_ref.pdbx_align_begin 364 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M6N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UKT4 _struct_ref_seq.db_align_beg 364 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 447 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M6N GLY A 1 ? UNP Q9UKT4 ? ? 'EXPRESSION TAG' 1 1 1 2M6N SER A 2 ? UNP Q9UKT4 ? ? 'EXPRESSION TAG' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-15N HSQC' 1 3 1 '2D 1H-13C HSQC' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCA' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8 mM [U-100% 13C; U-100% 15N] F-box only protein 5, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M6N _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.1997 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M6N _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.0093 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 0.86 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.21 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'Talos program' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M6N _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M6N _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M6N _struct.title '3D solution structure of EMI1 (Early Mitotic Inhibitor 1)' _struct.pdbx_descriptor 'F-box only protein 5' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M6N _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'EMI1, APC, E3 ligase, ZBR, CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 15 ? ALA A 16 ? LYS A 15 ALA A 16 A 2 PRO A 23 ? ASP A 27 ? PRO A 23 ASP A 27 A 3 ARG A 32 ? CYS A 35 ? ARG A 32 CYS A 35 A 4 ASP A 43 ? CYS A 45 ? ASP A 43 CYS A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 15 ? N LYS A 15 O ALA A 24 ? O ALA A 24 A 2 3 N ASP A 27 ? N ASP A 27 O ARG A 32 ? O ARG A 32 A 3 4 N ALA A 33 ? N ALA A 33 O TYR A 44 ? O TYR A 44 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 2 AC1 4 CYS A 20 ? CYS A 20 . ? 1_555 ? 3 AC1 4 CYS A 35 ? CYS A 35 . ? 1_555 ? 4 AC1 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 5 AC2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 6 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 7 AC2 4 HIS A 53 ? HIS A 53 . ? 1_555 ? 8 AC2 4 CYS A 58 ? CYS A 58 . ? 1_555 ? # _atom_sites.entry_id 2M6N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 LYS 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ASN 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 ? ? ? A . n A 1 60 ASP 60 60 ? ? ? A . n A 1 61 GLY 61 61 ? ? ? A . n A 1 62 LYS 62 62 ? ? ? A . n A 1 63 LEU 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 LYS 65 65 ? ? ? A . n A 1 66 ALA 66 66 ? ? ? A . n A 1 67 SER 67 67 ? ? ? A . n A 1 68 CYS 68 68 ? ? ? A . n A 1 69 LYS 69 69 ? ? ? A . n A 1 70 ILE 70 70 ? ? ? A . n A 1 71 GLY 71 71 ? ? ? A . n A 1 72 PRO 72 72 ? ? ? A . n A 1 73 LEU 73 73 ? ? ? A . n A 1 74 PRO 74 74 ? ? ? A . n A 1 75 GLY 75 75 ? ? ? A . n A 1 76 THR 76 76 ? ? ? A . n A 1 77 LYS 77 77 ? ? ? A . n A 1 78 LYS 78 78 ? ? ? A . n A 1 79 SER 79 79 ? ? ? A . n A 1 80 LYS 80 80 ? ? ? A . n A 1 81 LYS 81 81 ? ? ? A . n A 1 82 ASN 82 82 ? ? ? A . n A 1 83 LEU 83 83 ? ? ? A . n A 1 84 ARG 84 84 ? ? ? A . n A 1 85 ARG 85 85 ? ? ? A . n A 1 86 LEU 86 86 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 91 ZN ZN A . C 2 ZN 1 102 101 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-29 2 'Structure model' 1 1 2013-06-12 3 'Structure model' 1 2 2013-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.046 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.004 _pdbx_nmr_ensemble_rms.entry_id 2M6N _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_exptl_sample.component 'F-box only protein 5' _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M6N _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 931 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 211 _pdbx_nmr_constraints.NOE_long_range_total_count 256 _pdbx_nmr_constraints.NOE_medium_range_total_count 0 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 83 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 19 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 19 ? ? -99.01 -72.38 2 1 PRO A 23 ? ? -69.72 91.11 3 1 LYS A 25 ? ? -58.73 102.41 4 1 LYS A 36 ? ? -95.36 34.48 5 1 CYS A 40 ? ? -123.29 -79.88 6 1 LYS A 56 ? ? -79.32 -74.87 7 2 ARG A 19 ? ? -98.18 -69.65 8 2 LYS A 25 ? ? -54.21 105.86 9 2 LYS A 36 ? ? -97.36 31.24 10 2 CYS A 40 ? ? -113.03 -78.91 11 2 THR A 54 ? ? -166.74 28.16 12 2 THR A 55 ? ? -141.63 28.09 13 2 ASP A 57 ? ? -179.39 118.55 14 3 LYS A 25 ? ? -56.46 109.53 15 3 LYS A 36 ? ? -95.17 31.96 16 3 CYS A 40 ? ? -108.89 -79.05 17 3 HIS A 53 ? ? -62.07 95.47 18 3 THR A 54 ? ? -127.56 -70.70 19 3 THR A 55 ? ? -58.06 -70.78 20 3 LYS A 56 ? ? -133.29 -64.46 21 4 ARG A 19 ? ? -94.31 -66.48 22 4 ASN A 21 ? ? 52.06 76.61 23 4 LYS A 25 ? ? -58.50 98.28 24 4 CYS A 40 ? ? -104.39 -77.77 25 4 THR A 54 ? ? -127.05 -74.00 26 5 LYS A 25 ? ? -59.72 100.79 27 5 CYS A 40 ? ? -103.50 -77.51 28 5 HIS A 53 ? ? -51.69 -75.34 29 5 THR A 55 ? ? -174.87 -178.51 30 6 CYS A 20 ? ? -140.23 23.74 31 6 CYS A 40 ? ? -110.79 -78.86 32 6 THR A 55 ? ? -125.01 -169.97 33 7 ASN A 21 ? ? 52.47 73.69 34 7 LYS A 25 ? ? -57.27 109.22 35 7 CYS A 40 ? ? -107.26 -79.23 36 8 ARG A 19 ? ? -99.28 -68.83 37 8 LYS A 25 ? ? -55.19 104.03 38 8 LYS A 36 ? ? -92.16 43.27 39 8 CYS A 40 ? ? -91.50 -78.86 40 8 TYR A 52 ? ? -51.73 170.08 41 8 LYS A 56 ? ? -179.45 -176.45 42 9 ARG A 19 ? ? -97.90 -72.21 43 9 PRO A 23 ? ? -69.74 89.39 44 9 LYS A 25 ? ? -61.57 99.01 45 9 CYS A 40 ? ? -98.55 -78.63 46 9 LYS A 47 ? ? -73.41 -71.74 47 9 THR A 54 ? ? -101.78 -74.16 48 9 THR A 55 ? ? -130.16 -41.25 49 10 ARG A 19 ? ? -96.62 -69.57 50 10 PRO A 23 ? ? -69.84 98.62 51 10 CYS A 40 ? ? -104.80 -79.15 52 10 LYS A 47 ? ? -72.63 -70.53 53 10 THR A 54 ? ? -72.88 -74.87 54 11 ARG A 19 ? ? -96.62 -71.27 55 11 PRO A 23 ? ? -69.84 90.15 56 11 LYS A 25 ? ? -57.90 104.56 57 11 CYS A 40 ? ? -109.12 -78.39 58 11 HIS A 53 ? ? -61.73 97.21 59 11 THR A 54 ? ? -132.42 -67.46 60 11 LYS A 56 ? ? -144.87 -74.15 61 12 ARG A 19 ? ? -102.61 -60.03 62 12 LYS A 25 ? ? -49.82 107.54 63 12 LYS A 36 ? ? -95.44 30.21 64 12 CYS A 40 ? ? -121.28 -78.43 65 12 TYR A 52 ? ? -57.02 170.48 66 12 LYS A 56 ? ? 177.53 -168.87 67 13 CYS A 40 ? ? -107.22 -76.59 68 13 HIS A 53 ? ? -52.18 -73.88 69 13 ASP A 57 ? ? -48.35 104.61 70 14 CYS A 40 ? ? -102.53 -77.48 71 14 HIS A 53 ? ? -51.15 -75.36 72 14 THR A 54 ? ? 47.43 28.26 73 15 ARG A 19 ? ? -96.89 -70.55 74 15 ASN A 21 ? ? 51.85 73.00 75 15 LYS A 25 ? ? -55.33 108.19 76 15 LYS A 36 ? ? -96.60 44.62 77 15 CYS A 40 ? ? -136.97 -78.26 78 15 THR A 54 ? ? -139.62 -50.37 79 16 ARG A 19 ? ? -97.35 -68.75 80 16 LYS A 25 ? ? -59.49 101.88 81 16 CYS A 40 ? ? -100.65 -78.75 82 16 LYS A 56 ? ? 179.87 -172.90 83 17 CYS A 17 ? ? -48.19 150.55 84 17 CYS A 40 ? ? -101.66 -77.71 85 17 THR A 54 ? ? -99.81 -75.22 86 18 LYS A 25 ? ? -59.07 106.21 87 18 LYS A 36 ? ? -94.69 37.05 88 18 CYS A 40 ? ? -114.58 -80.04 89 18 LEU A 49 ? ? 52.96 71.52 90 18 LYS A 56 ? ? 179.21 -171.84 91 19 ARG A 19 ? ? -96.68 -70.09 92 19 ASN A 21 ? ? 51.79 73.49 93 19 PRO A 23 ? ? -69.78 99.20 94 19 LYS A 25 ? ? -51.82 107.76 95 19 LYS A 36 ? ? -92.95 41.13 96 19 CYS A 40 ? ? -86.09 -79.15 97 20 CYS A 17 ? ? -49.85 150.76 98 20 CYS A 20 ? ? -140.30 25.83 99 20 LYS A 25 ? ? -49.56 103.87 100 20 CYS A 40 ? ? -134.56 -79.87 101 20 THR A 54 ? ? -105.11 -69.38 102 20 THR A 55 ? ? -53.91 -70.89 103 20 LYS A 56 ? ? -136.58 -62.78 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A LYS 9 ? A LYS 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A ASN 11 ? A ASN 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A SER 59 ? A SER 59 14 1 Y 1 A ASP 60 ? A ASP 60 15 1 Y 1 A GLY 61 ? A GLY 61 16 1 Y 1 A LYS 62 ? A LYS 62 17 1 Y 1 A LEU 63 ? A LEU 63 18 1 Y 1 A LEU 64 ? A LEU 64 19 1 Y 1 A LYS 65 ? A LYS 65 20 1 Y 1 A ALA 66 ? A ALA 66 21 1 Y 1 A SER 67 ? A SER 67 22 1 Y 1 A CYS 68 ? A CYS 68 23 1 Y 1 A LYS 69 ? A LYS 69 24 1 Y 1 A ILE 70 ? A ILE 70 25 1 Y 1 A GLY 71 ? A GLY 71 26 1 Y 1 A PRO 72 ? A PRO 72 27 1 Y 1 A LEU 73 ? A LEU 73 28 1 Y 1 A PRO 74 ? A PRO 74 29 1 Y 1 A GLY 75 ? A GLY 75 30 1 Y 1 A THR 76 ? A THR 76 31 1 Y 1 A LYS 77 ? A LYS 77 32 1 Y 1 A LYS 78 ? A LYS 78 33 1 Y 1 A SER 79 ? A SER 79 34 1 Y 1 A LYS 80 ? A LYS 80 35 1 Y 1 A LYS 81 ? A LYS 81 36 1 Y 1 A ASN 82 ? A ASN 82 37 1 Y 1 A LEU 83 ? A LEU 83 38 1 Y 1 A ARG 84 ? A ARG 84 39 1 Y 1 A ARG 85 ? A ARG 85 40 1 Y 1 A LEU 86 ? A LEU 86 41 2 Y 1 A GLY 1 ? A GLY 1 42 2 Y 1 A SER 2 ? A SER 2 43 2 Y 1 A GLU 3 ? A GLU 3 44 2 Y 1 A VAL 4 ? A VAL 4 45 2 Y 1 A ALA 5 ? A ALA 5 46 2 Y 1 A LYS 6 ? A LYS 6 47 2 Y 1 A THR 7 ? A THR 7 48 2 Y 1 A LEU 8 ? A LEU 8 49 2 Y 1 A LYS 9 ? A LYS 9 50 2 Y 1 A LYS 10 ? A LYS 10 51 2 Y 1 A ASN 11 ? A ASN 11 52 2 Y 1 A GLU 12 ? A GLU 12 53 2 Y 1 A SER 59 ? A SER 59 54 2 Y 1 A ASP 60 ? A ASP 60 55 2 Y 1 A GLY 61 ? A GLY 61 56 2 Y 1 A LYS 62 ? A LYS 62 57 2 Y 1 A LEU 63 ? A LEU 63 58 2 Y 1 A LEU 64 ? A LEU 64 59 2 Y 1 A LYS 65 ? A LYS 65 60 2 Y 1 A ALA 66 ? A ALA 66 61 2 Y 1 A SER 67 ? A SER 67 62 2 Y 1 A CYS 68 ? A CYS 68 63 2 Y 1 A LYS 69 ? A LYS 69 64 2 Y 1 A ILE 70 ? A ILE 70 65 2 Y 1 A GLY 71 ? A GLY 71 66 2 Y 1 A PRO 72 ? A PRO 72 67 2 Y 1 A LEU 73 ? A LEU 73 68 2 Y 1 A PRO 74 ? A PRO 74 69 2 Y 1 A GLY 75 ? A GLY 75 70 2 Y 1 A THR 76 ? A THR 76 71 2 Y 1 A LYS 77 ? A LYS 77 72 2 Y 1 A LYS 78 ? A LYS 78 73 2 Y 1 A SER 79 ? A SER 79 74 2 Y 1 A LYS 80 ? A LYS 80 75 2 Y 1 A LYS 81 ? A LYS 81 76 2 Y 1 A ASN 82 ? A ASN 82 77 2 Y 1 A LEU 83 ? A LEU 83 78 2 Y 1 A ARG 84 ? A ARG 84 79 2 Y 1 A ARG 85 ? A ARG 85 80 2 Y 1 A LEU 86 ? A LEU 86 81 3 Y 1 A GLY 1 ? A GLY 1 82 3 Y 1 A SER 2 ? A SER 2 83 3 Y 1 A GLU 3 ? A GLU 3 84 3 Y 1 A VAL 4 ? A VAL 4 85 3 Y 1 A ALA 5 ? A ALA 5 86 3 Y 1 A LYS 6 ? A LYS 6 87 3 Y 1 A THR 7 ? A THR 7 88 3 Y 1 A LEU 8 ? A LEU 8 89 3 Y 1 A LYS 9 ? A LYS 9 90 3 Y 1 A LYS 10 ? A LYS 10 91 3 Y 1 A ASN 11 ? A ASN 11 92 3 Y 1 A GLU 12 ? A GLU 12 93 3 Y 1 A SER 59 ? A SER 59 94 3 Y 1 A ASP 60 ? A ASP 60 95 3 Y 1 A GLY 61 ? A GLY 61 96 3 Y 1 A LYS 62 ? A LYS 62 97 3 Y 1 A LEU 63 ? A LEU 63 98 3 Y 1 A LEU 64 ? A LEU 64 99 3 Y 1 A LYS 65 ? A LYS 65 100 3 Y 1 A ALA 66 ? A ALA 66 101 3 Y 1 A SER 67 ? A SER 67 102 3 Y 1 A CYS 68 ? A CYS 68 103 3 Y 1 A LYS 69 ? A LYS 69 104 3 Y 1 A ILE 70 ? A ILE 70 105 3 Y 1 A GLY 71 ? A GLY 71 106 3 Y 1 A PRO 72 ? A PRO 72 107 3 Y 1 A LEU 73 ? A LEU 73 108 3 Y 1 A PRO 74 ? A PRO 74 109 3 Y 1 A GLY 75 ? A GLY 75 110 3 Y 1 A THR 76 ? A THR 76 111 3 Y 1 A LYS 77 ? A LYS 77 112 3 Y 1 A LYS 78 ? A LYS 78 113 3 Y 1 A SER 79 ? A SER 79 114 3 Y 1 A LYS 80 ? A LYS 80 115 3 Y 1 A LYS 81 ? A LYS 81 116 3 Y 1 A ASN 82 ? A ASN 82 117 3 Y 1 A LEU 83 ? A LEU 83 118 3 Y 1 A ARG 84 ? A ARG 84 119 3 Y 1 A ARG 85 ? A ARG 85 120 3 Y 1 A LEU 86 ? A LEU 86 121 4 Y 1 A GLY 1 ? A GLY 1 122 4 Y 1 A SER 2 ? A SER 2 123 4 Y 1 A GLU 3 ? A GLU 3 124 4 Y 1 A VAL 4 ? A VAL 4 125 4 Y 1 A ALA 5 ? A ALA 5 126 4 Y 1 A LYS 6 ? A LYS 6 127 4 Y 1 A THR 7 ? A THR 7 128 4 Y 1 A LEU 8 ? A LEU 8 129 4 Y 1 A LYS 9 ? A LYS 9 130 4 Y 1 A LYS 10 ? A LYS 10 131 4 Y 1 A ASN 11 ? A ASN 11 132 4 Y 1 A GLU 12 ? A GLU 12 133 4 Y 1 A SER 59 ? A SER 59 134 4 Y 1 A ASP 60 ? A ASP 60 135 4 Y 1 A GLY 61 ? A GLY 61 136 4 Y 1 A LYS 62 ? A LYS 62 137 4 Y 1 A LEU 63 ? A LEU 63 138 4 Y 1 A LEU 64 ? A LEU 64 139 4 Y 1 A LYS 65 ? A LYS 65 140 4 Y 1 A ALA 66 ? A ALA 66 141 4 Y 1 A SER 67 ? A SER 67 142 4 Y 1 A CYS 68 ? A CYS 68 143 4 Y 1 A LYS 69 ? A LYS 69 144 4 Y 1 A ILE 70 ? A ILE 70 145 4 Y 1 A GLY 71 ? A GLY 71 146 4 Y 1 A PRO 72 ? A PRO 72 147 4 Y 1 A LEU 73 ? A LEU 73 148 4 Y 1 A PRO 74 ? A PRO 74 149 4 Y 1 A GLY 75 ? A GLY 75 150 4 Y 1 A THR 76 ? A THR 76 151 4 Y 1 A LYS 77 ? A LYS 77 152 4 Y 1 A LYS 78 ? A LYS 78 153 4 Y 1 A SER 79 ? A SER 79 154 4 Y 1 A LYS 80 ? A LYS 80 155 4 Y 1 A LYS 81 ? A LYS 81 156 4 Y 1 A ASN 82 ? A ASN 82 157 4 Y 1 A LEU 83 ? A LEU 83 158 4 Y 1 A ARG 84 ? A ARG 84 159 4 Y 1 A ARG 85 ? A ARG 85 160 4 Y 1 A LEU 86 ? A LEU 86 161 5 Y 1 A GLY 1 ? A GLY 1 162 5 Y 1 A SER 2 ? A SER 2 163 5 Y 1 A GLU 3 ? A GLU 3 164 5 Y 1 A VAL 4 ? A VAL 4 165 5 Y 1 A ALA 5 ? A ALA 5 166 5 Y 1 A LYS 6 ? A LYS 6 167 5 Y 1 A THR 7 ? A THR 7 168 5 Y 1 A LEU 8 ? A LEU 8 169 5 Y 1 A LYS 9 ? A LYS 9 170 5 Y 1 A LYS 10 ? A LYS 10 171 5 Y 1 A ASN 11 ? A ASN 11 172 5 Y 1 A GLU 12 ? A GLU 12 173 5 Y 1 A SER 59 ? A SER 59 174 5 Y 1 A ASP 60 ? A ASP 60 175 5 Y 1 A GLY 61 ? A GLY 61 176 5 Y 1 A LYS 62 ? A LYS 62 177 5 Y 1 A LEU 63 ? A LEU 63 178 5 Y 1 A LEU 64 ? A LEU 64 179 5 Y 1 A LYS 65 ? A LYS 65 180 5 Y 1 A ALA 66 ? A ALA 66 181 5 Y 1 A SER 67 ? A SER 67 182 5 Y 1 A CYS 68 ? A CYS 68 183 5 Y 1 A LYS 69 ? A LYS 69 184 5 Y 1 A ILE 70 ? A ILE 70 185 5 Y 1 A GLY 71 ? A GLY 71 186 5 Y 1 A PRO 72 ? A PRO 72 187 5 Y 1 A LEU 73 ? A LEU 73 188 5 Y 1 A PRO 74 ? A PRO 74 189 5 Y 1 A GLY 75 ? A GLY 75 190 5 Y 1 A THR 76 ? A THR 76 191 5 Y 1 A LYS 77 ? A LYS 77 192 5 Y 1 A LYS 78 ? A LYS 78 193 5 Y 1 A SER 79 ? A SER 79 194 5 Y 1 A LYS 80 ? A LYS 80 195 5 Y 1 A LYS 81 ? A LYS 81 196 5 Y 1 A ASN 82 ? A ASN 82 197 5 Y 1 A LEU 83 ? A LEU 83 198 5 Y 1 A ARG 84 ? A ARG 84 199 5 Y 1 A ARG 85 ? A ARG 85 200 5 Y 1 A LEU 86 ? A LEU 86 201 6 Y 1 A GLY 1 ? A GLY 1 202 6 Y 1 A SER 2 ? A SER 2 203 6 Y 1 A GLU 3 ? A GLU 3 204 6 Y 1 A VAL 4 ? A VAL 4 205 6 Y 1 A ALA 5 ? A ALA 5 206 6 Y 1 A LYS 6 ? A LYS 6 207 6 Y 1 A THR 7 ? A THR 7 208 6 Y 1 A LEU 8 ? A LEU 8 209 6 Y 1 A LYS 9 ? A LYS 9 210 6 Y 1 A LYS 10 ? A LYS 10 211 6 Y 1 A ASN 11 ? A ASN 11 212 6 Y 1 A GLU 12 ? A GLU 12 213 6 Y 1 A SER 59 ? A SER 59 214 6 Y 1 A ASP 60 ? A ASP 60 215 6 Y 1 A GLY 61 ? A GLY 61 216 6 Y 1 A LYS 62 ? A LYS 62 217 6 Y 1 A LEU 63 ? A LEU 63 218 6 Y 1 A LEU 64 ? A LEU 64 219 6 Y 1 A LYS 65 ? A LYS 65 220 6 Y 1 A ALA 66 ? A ALA 66 221 6 Y 1 A SER 67 ? A SER 67 222 6 Y 1 A CYS 68 ? A CYS 68 223 6 Y 1 A LYS 69 ? A LYS 69 224 6 Y 1 A ILE 70 ? A ILE 70 225 6 Y 1 A GLY 71 ? A GLY 71 226 6 Y 1 A PRO 72 ? A PRO 72 227 6 Y 1 A LEU 73 ? A LEU 73 228 6 Y 1 A PRO 74 ? A PRO 74 229 6 Y 1 A GLY 75 ? A GLY 75 230 6 Y 1 A THR 76 ? A THR 76 231 6 Y 1 A LYS 77 ? A LYS 77 232 6 Y 1 A LYS 78 ? A LYS 78 233 6 Y 1 A SER 79 ? A SER 79 234 6 Y 1 A LYS 80 ? A LYS 80 235 6 Y 1 A LYS 81 ? A LYS 81 236 6 Y 1 A ASN 82 ? A ASN 82 237 6 Y 1 A LEU 83 ? A LEU 83 238 6 Y 1 A ARG 84 ? A ARG 84 239 6 Y 1 A ARG 85 ? A ARG 85 240 6 Y 1 A LEU 86 ? A LEU 86 241 7 Y 1 A GLY 1 ? A GLY 1 242 7 Y 1 A SER 2 ? A SER 2 243 7 Y 1 A GLU 3 ? A GLU 3 244 7 Y 1 A VAL 4 ? A VAL 4 245 7 Y 1 A ALA 5 ? A ALA 5 246 7 Y 1 A LYS 6 ? A LYS 6 247 7 Y 1 A THR 7 ? A THR 7 248 7 Y 1 A LEU 8 ? A LEU 8 249 7 Y 1 A LYS 9 ? A LYS 9 250 7 Y 1 A LYS 10 ? A LYS 10 251 7 Y 1 A ASN 11 ? A ASN 11 252 7 Y 1 A GLU 12 ? A GLU 12 253 7 Y 1 A SER 59 ? A SER 59 254 7 Y 1 A ASP 60 ? A ASP 60 255 7 Y 1 A GLY 61 ? A GLY 61 256 7 Y 1 A LYS 62 ? A LYS 62 257 7 Y 1 A LEU 63 ? A LEU 63 258 7 Y 1 A LEU 64 ? A LEU 64 259 7 Y 1 A LYS 65 ? A LYS 65 260 7 Y 1 A ALA 66 ? A ALA 66 261 7 Y 1 A SER 67 ? A SER 67 262 7 Y 1 A CYS 68 ? A CYS 68 263 7 Y 1 A LYS 69 ? A LYS 69 264 7 Y 1 A ILE 70 ? A ILE 70 265 7 Y 1 A GLY 71 ? A GLY 71 266 7 Y 1 A PRO 72 ? A PRO 72 267 7 Y 1 A LEU 73 ? A LEU 73 268 7 Y 1 A PRO 74 ? A PRO 74 269 7 Y 1 A GLY 75 ? A GLY 75 270 7 Y 1 A THR 76 ? A THR 76 271 7 Y 1 A LYS 77 ? A LYS 77 272 7 Y 1 A LYS 78 ? A LYS 78 273 7 Y 1 A SER 79 ? A SER 79 274 7 Y 1 A LYS 80 ? A LYS 80 275 7 Y 1 A LYS 81 ? A LYS 81 276 7 Y 1 A ASN 82 ? A ASN 82 277 7 Y 1 A LEU 83 ? A LEU 83 278 7 Y 1 A ARG 84 ? A ARG 84 279 7 Y 1 A ARG 85 ? A ARG 85 280 7 Y 1 A LEU 86 ? A LEU 86 281 8 Y 1 A GLY 1 ? A GLY 1 282 8 Y 1 A SER 2 ? A SER 2 283 8 Y 1 A GLU 3 ? A GLU 3 284 8 Y 1 A VAL 4 ? A VAL 4 285 8 Y 1 A ALA 5 ? A ALA 5 286 8 Y 1 A LYS 6 ? A LYS 6 287 8 Y 1 A THR 7 ? A THR 7 288 8 Y 1 A LEU 8 ? A LEU 8 289 8 Y 1 A LYS 9 ? A LYS 9 290 8 Y 1 A LYS 10 ? A LYS 10 291 8 Y 1 A ASN 11 ? A ASN 11 292 8 Y 1 A GLU 12 ? A GLU 12 293 8 Y 1 A SER 59 ? A SER 59 294 8 Y 1 A ASP 60 ? A ASP 60 295 8 Y 1 A GLY 61 ? A GLY 61 296 8 Y 1 A LYS 62 ? A LYS 62 297 8 Y 1 A LEU 63 ? A LEU 63 298 8 Y 1 A LEU 64 ? A LEU 64 299 8 Y 1 A LYS 65 ? A LYS 65 300 8 Y 1 A ALA 66 ? A ALA 66 301 8 Y 1 A SER 67 ? A SER 67 302 8 Y 1 A CYS 68 ? A CYS 68 303 8 Y 1 A LYS 69 ? A LYS 69 304 8 Y 1 A ILE 70 ? A ILE 70 305 8 Y 1 A GLY 71 ? A GLY 71 306 8 Y 1 A PRO 72 ? A PRO 72 307 8 Y 1 A LEU 73 ? A LEU 73 308 8 Y 1 A PRO 74 ? A PRO 74 309 8 Y 1 A GLY 75 ? A GLY 75 310 8 Y 1 A THR 76 ? A THR 76 311 8 Y 1 A LYS 77 ? A LYS 77 312 8 Y 1 A LYS 78 ? A LYS 78 313 8 Y 1 A SER 79 ? A SER 79 314 8 Y 1 A LYS 80 ? A LYS 80 315 8 Y 1 A LYS 81 ? A LYS 81 316 8 Y 1 A ASN 82 ? A ASN 82 317 8 Y 1 A LEU 83 ? A LEU 83 318 8 Y 1 A ARG 84 ? A ARG 84 319 8 Y 1 A ARG 85 ? A ARG 85 320 8 Y 1 A LEU 86 ? A LEU 86 321 9 Y 1 A GLY 1 ? A GLY 1 322 9 Y 1 A SER 2 ? A SER 2 323 9 Y 1 A GLU 3 ? A GLU 3 324 9 Y 1 A VAL 4 ? A VAL 4 325 9 Y 1 A ALA 5 ? A ALA 5 326 9 Y 1 A LYS 6 ? A LYS 6 327 9 Y 1 A THR 7 ? A THR 7 328 9 Y 1 A LEU 8 ? A LEU 8 329 9 Y 1 A LYS 9 ? A LYS 9 330 9 Y 1 A LYS 10 ? A LYS 10 331 9 Y 1 A ASN 11 ? A ASN 11 332 9 Y 1 A GLU 12 ? A GLU 12 333 9 Y 1 A SER 59 ? A SER 59 334 9 Y 1 A ASP 60 ? A ASP 60 335 9 Y 1 A GLY 61 ? A GLY 61 336 9 Y 1 A LYS 62 ? A LYS 62 337 9 Y 1 A LEU 63 ? A LEU 63 338 9 Y 1 A LEU 64 ? A LEU 64 339 9 Y 1 A LYS 65 ? A LYS 65 340 9 Y 1 A ALA 66 ? A ALA 66 341 9 Y 1 A SER 67 ? A SER 67 342 9 Y 1 A CYS 68 ? A CYS 68 343 9 Y 1 A LYS 69 ? A LYS 69 344 9 Y 1 A ILE 70 ? A ILE 70 345 9 Y 1 A GLY 71 ? A GLY 71 346 9 Y 1 A PRO 72 ? A PRO 72 347 9 Y 1 A LEU 73 ? A LEU 73 348 9 Y 1 A PRO 74 ? A PRO 74 349 9 Y 1 A GLY 75 ? A GLY 75 350 9 Y 1 A THR 76 ? A THR 76 351 9 Y 1 A LYS 77 ? A LYS 77 352 9 Y 1 A LYS 78 ? A LYS 78 353 9 Y 1 A SER 79 ? A SER 79 354 9 Y 1 A LYS 80 ? A LYS 80 355 9 Y 1 A LYS 81 ? A LYS 81 356 9 Y 1 A ASN 82 ? A ASN 82 357 9 Y 1 A LEU 83 ? A LEU 83 358 9 Y 1 A ARG 84 ? A ARG 84 359 9 Y 1 A ARG 85 ? A ARG 85 360 9 Y 1 A LEU 86 ? A LEU 86 361 10 Y 1 A GLY 1 ? A GLY 1 362 10 Y 1 A SER 2 ? A SER 2 363 10 Y 1 A GLU 3 ? A GLU 3 364 10 Y 1 A VAL 4 ? A VAL 4 365 10 Y 1 A ALA 5 ? A ALA 5 366 10 Y 1 A LYS 6 ? A LYS 6 367 10 Y 1 A THR 7 ? A THR 7 368 10 Y 1 A LEU 8 ? A LEU 8 369 10 Y 1 A LYS 9 ? A LYS 9 370 10 Y 1 A LYS 10 ? A LYS 10 371 10 Y 1 A ASN 11 ? A ASN 11 372 10 Y 1 A GLU 12 ? A GLU 12 373 10 Y 1 A SER 59 ? A SER 59 374 10 Y 1 A ASP 60 ? A ASP 60 375 10 Y 1 A GLY 61 ? A GLY 61 376 10 Y 1 A LYS 62 ? A LYS 62 377 10 Y 1 A LEU 63 ? A LEU 63 378 10 Y 1 A LEU 64 ? A LEU 64 379 10 Y 1 A LYS 65 ? A LYS 65 380 10 Y 1 A ALA 66 ? A ALA 66 381 10 Y 1 A SER 67 ? A SER 67 382 10 Y 1 A CYS 68 ? A CYS 68 383 10 Y 1 A LYS 69 ? A LYS 69 384 10 Y 1 A ILE 70 ? A ILE 70 385 10 Y 1 A GLY 71 ? A GLY 71 386 10 Y 1 A PRO 72 ? A PRO 72 387 10 Y 1 A LEU 73 ? A LEU 73 388 10 Y 1 A PRO 74 ? A PRO 74 389 10 Y 1 A GLY 75 ? A GLY 75 390 10 Y 1 A THR 76 ? A THR 76 391 10 Y 1 A LYS 77 ? A LYS 77 392 10 Y 1 A LYS 78 ? A LYS 78 393 10 Y 1 A SER 79 ? A SER 79 394 10 Y 1 A LYS 80 ? A LYS 80 395 10 Y 1 A LYS 81 ? A LYS 81 396 10 Y 1 A ASN 82 ? A ASN 82 397 10 Y 1 A LEU 83 ? A LEU 83 398 10 Y 1 A ARG 84 ? A ARG 84 399 10 Y 1 A ARG 85 ? A ARG 85 400 10 Y 1 A LEU 86 ? A LEU 86 401 11 Y 1 A GLY 1 ? A GLY 1 402 11 Y 1 A SER 2 ? A SER 2 403 11 Y 1 A GLU 3 ? A GLU 3 404 11 Y 1 A VAL 4 ? A VAL 4 405 11 Y 1 A ALA 5 ? A ALA 5 406 11 Y 1 A LYS 6 ? A LYS 6 407 11 Y 1 A THR 7 ? A THR 7 408 11 Y 1 A LEU 8 ? A LEU 8 409 11 Y 1 A LYS 9 ? A LYS 9 410 11 Y 1 A LYS 10 ? A LYS 10 411 11 Y 1 A ASN 11 ? A ASN 11 412 11 Y 1 A GLU 12 ? A GLU 12 413 11 Y 1 A SER 59 ? A SER 59 414 11 Y 1 A ASP 60 ? A ASP 60 415 11 Y 1 A GLY 61 ? A GLY 61 416 11 Y 1 A LYS 62 ? A LYS 62 417 11 Y 1 A LEU 63 ? A LEU 63 418 11 Y 1 A LEU 64 ? A LEU 64 419 11 Y 1 A LYS 65 ? A LYS 65 420 11 Y 1 A ALA 66 ? A ALA 66 421 11 Y 1 A SER 67 ? A SER 67 422 11 Y 1 A CYS 68 ? A CYS 68 423 11 Y 1 A LYS 69 ? A LYS 69 424 11 Y 1 A ILE 70 ? A ILE 70 425 11 Y 1 A GLY 71 ? A GLY 71 426 11 Y 1 A PRO 72 ? A PRO 72 427 11 Y 1 A LEU 73 ? A LEU 73 428 11 Y 1 A PRO 74 ? A PRO 74 429 11 Y 1 A GLY 75 ? A GLY 75 430 11 Y 1 A THR 76 ? A THR 76 431 11 Y 1 A LYS 77 ? A LYS 77 432 11 Y 1 A LYS 78 ? A LYS 78 433 11 Y 1 A SER 79 ? A SER 79 434 11 Y 1 A LYS 80 ? A LYS 80 435 11 Y 1 A LYS 81 ? A LYS 81 436 11 Y 1 A ASN 82 ? A ASN 82 437 11 Y 1 A LEU 83 ? A LEU 83 438 11 Y 1 A ARG 84 ? A ARG 84 439 11 Y 1 A ARG 85 ? A ARG 85 440 11 Y 1 A LEU 86 ? A LEU 86 441 12 Y 1 A GLY 1 ? A GLY 1 442 12 Y 1 A SER 2 ? A SER 2 443 12 Y 1 A GLU 3 ? A GLU 3 444 12 Y 1 A VAL 4 ? A VAL 4 445 12 Y 1 A ALA 5 ? A ALA 5 446 12 Y 1 A LYS 6 ? A LYS 6 447 12 Y 1 A THR 7 ? A THR 7 448 12 Y 1 A LEU 8 ? A LEU 8 449 12 Y 1 A LYS 9 ? A LYS 9 450 12 Y 1 A LYS 10 ? A LYS 10 451 12 Y 1 A ASN 11 ? A ASN 11 452 12 Y 1 A GLU 12 ? A GLU 12 453 12 Y 1 A SER 59 ? A SER 59 454 12 Y 1 A ASP 60 ? A ASP 60 455 12 Y 1 A GLY 61 ? A GLY 61 456 12 Y 1 A LYS 62 ? A LYS 62 457 12 Y 1 A LEU 63 ? A LEU 63 458 12 Y 1 A LEU 64 ? A LEU 64 459 12 Y 1 A LYS 65 ? A LYS 65 460 12 Y 1 A ALA 66 ? A ALA 66 461 12 Y 1 A SER 67 ? A SER 67 462 12 Y 1 A CYS 68 ? A CYS 68 463 12 Y 1 A LYS 69 ? A LYS 69 464 12 Y 1 A ILE 70 ? A ILE 70 465 12 Y 1 A GLY 71 ? A GLY 71 466 12 Y 1 A PRO 72 ? A PRO 72 467 12 Y 1 A LEU 73 ? A LEU 73 468 12 Y 1 A PRO 74 ? A PRO 74 469 12 Y 1 A GLY 75 ? A GLY 75 470 12 Y 1 A THR 76 ? A THR 76 471 12 Y 1 A LYS 77 ? A LYS 77 472 12 Y 1 A LYS 78 ? A LYS 78 473 12 Y 1 A SER 79 ? A SER 79 474 12 Y 1 A LYS 80 ? A LYS 80 475 12 Y 1 A LYS 81 ? A LYS 81 476 12 Y 1 A ASN 82 ? A ASN 82 477 12 Y 1 A LEU 83 ? A LEU 83 478 12 Y 1 A ARG 84 ? A ARG 84 479 12 Y 1 A ARG 85 ? A ARG 85 480 12 Y 1 A LEU 86 ? A LEU 86 481 13 Y 1 A GLY 1 ? A GLY 1 482 13 Y 1 A SER 2 ? A SER 2 483 13 Y 1 A GLU 3 ? A GLU 3 484 13 Y 1 A VAL 4 ? A VAL 4 485 13 Y 1 A ALA 5 ? A ALA 5 486 13 Y 1 A LYS 6 ? A LYS 6 487 13 Y 1 A THR 7 ? A THR 7 488 13 Y 1 A LEU 8 ? A LEU 8 489 13 Y 1 A LYS 9 ? A LYS 9 490 13 Y 1 A LYS 10 ? A LYS 10 491 13 Y 1 A ASN 11 ? A ASN 11 492 13 Y 1 A GLU 12 ? A GLU 12 493 13 Y 1 A SER 59 ? A SER 59 494 13 Y 1 A ASP 60 ? A ASP 60 495 13 Y 1 A GLY 61 ? A GLY 61 496 13 Y 1 A LYS 62 ? A LYS 62 497 13 Y 1 A LEU 63 ? A LEU 63 498 13 Y 1 A LEU 64 ? A LEU 64 499 13 Y 1 A LYS 65 ? A LYS 65 500 13 Y 1 A ALA 66 ? A ALA 66 501 13 Y 1 A SER 67 ? A SER 67 502 13 Y 1 A CYS 68 ? A CYS 68 503 13 Y 1 A LYS 69 ? A LYS 69 504 13 Y 1 A ILE 70 ? A ILE 70 505 13 Y 1 A GLY 71 ? A GLY 71 506 13 Y 1 A PRO 72 ? A PRO 72 507 13 Y 1 A LEU 73 ? A LEU 73 508 13 Y 1 A PRO 74 ? A PRO 74 509 13 Y 1 A GLY 75 ? A GLY 75 510 13 Y 1 A THR 76 ? A THR 76 511 13 Y 1 A LYS 77 ? A LYS 77 512 13 Y 1 A LYS 78 ? A LYS 78 513 13 Y 1 A SER 79 ? A SER 79 514 13 Y 1 A LYS 80 ? A LYS 80 515 13 Y 1 A LYS 81 ? A LYS 81 516 13 Y 1 A ASN 82 ? A ASN 82 517 13 Y 1 A LEU 83 ? A LEU 83 518 13 Y 1 A ARG 84 ? A ARG 84 519 13 Y 1 A ARG 85 ? A ARG 85 520 13 Y 1 A LEU 86 ? A LEU 86 521 14 Y 1 A GLY 1 ? A GLY 1 522 14 Y 1 A SER 2 ? A SER 2 523 14 Y 1 A GLU 3 ? A GLU 3 524 14 Y 1 A VAL 4 ? A VAL 4 525 14 Y 1 A ALA 5 ? A ALA 5 526 14 Y 1 A LYS 6 ? A LYS 6 527 14 Y 1 A THR 7 ? A THR 7 528 14 Y 1 A LEU 8 ? A LEU 8 529 14 Y 1 A LYS 9 ? A LYS 9 530 14 Y 1 A LYS 10 ? A LYS 10 531 14 Y 1 A ASN 11 ? A ASN 11 532 14 Y 1 A GLU 12 ? A GLU 12 533 14 Y 1 A SER 59 ? A SER 59 534 14 Y 1 A ASP 60 ? A ASP 60 535 14 Y 1 A GLY 61 ? A GLY 61 536 14 Y 1 A LYS 62 ? A LYS 62 537 14 Y 1 A LEU 63 ? A LEU 63 538 14 Y 1 A LEU 64 ? A LEU 64 539 14 Y 1 A LYS 65 ? A LYS 65 540 14 Y 1 A ALA 66 ? A ALA 66 541 14 Y 1 A SER 67 ? A SER 67 542 14 Y 1 A CYS 68 ? A CYS 68 543 14 Y 1 A LYS 69 ? A LYS 69 544 14 Y 1 A ILE 70 ? A ILE 70 545 14 Y 1 A GLY 71 ? A GLY 71 546 14 Y 1 A PRO 72 ? A PRO 72 547 14 Y 1 A LEU 73 ? A LEU 73 548 14 Y 1 A PRO 74 ? A PRO 74 549 14 Y 1 A GLY 75 ? A GLY 75 550 14 Y 1 A THR 76 ? A THR 76 551 14 Y 1 A LYS 77 ? A LYS 77 552 14 Y 1 A LYS 78 ? A LYS 78 553 14 Y 1 A SER 79 ? A SER 79 554 14 Y 1 A LYS 80 ? A LYS 80 555 14 Y 1 A LYS 81 ? A LYS 81 556 14 Y 1 A ASN 82 ? A ASN 82 557 14 Y 1 A LEU 83 ? A LEU 83 558 14 Y 1 A ARG 84 ? A ARG 84 559 14 Y 1 A ARG 85 ? A ARG 85 560 14 Y 1 A LEU 86 ? A LEU 86 561 15 Y 1 A GLY 1 ? A GLY 1 562 15 Y 1 A SER 2 ? A SER 2 563 15 Y 1 A GLU 3 ? A GLU 3 564 15 Y 1 A VAL 4 ? A VAL 4 565 15 Y 1 A ALA 5 ? A ALA 5 566 15 Y 1 A LYS 6 ? A LYS 6 567 15 Y 1 A THR 7 ? A THR 7 568 15 Y 1 A LEU 8 ? A LEU 8 569 15 Y 1 A LYS 9 ? A LYS 9 570 15 Y 1 A LYS 10 ? A LYS 10 571 15 Y 1 A ASN 11 ? A ASN 11 572 15 Y 1 A GLU 12 ? A GLU 12 573 15 Y 1 A SER 59 ? A SER 59 574 15 Y 1 A ASP 60 ? A ASP 60 575 15 Y 1 A GLY 61 ? A GLY 61 576 15 Y 1 A LYS 62 ? A LYS 62 577 15 Y 1 A LEU 63 ? A LEU 63 578 15 Y 1 A LEU 64 ? A LEU 64 579 15 Y 1 A LYS 65 ? A LYS 65 580 15 Y 1 A ALA 66 ? A ALA 66 581 15 Y 1 A SER 67 ? A SER 67 582 15 Y 1 A CYS 68 ? A CYS 68 583 15 Y 1 A LYS 69 ? A LYS 69 584 15 Y 1 A ILE 70 ? A ILE 70 585 15 Y 1 A GLY 71 ? A GLY 71 586 15 Y 1 A PRO 72 ? A PRO 72 587 15 Y 1 A LEU 73 ? A LEU 73 588 15 Y 1 A PRO 74 ? A PRO 74 589 15 Y 1 A GLY 75 ? A GLY 75 590 15 Y 1 A THR 76 ? A THR 76 591 15 Y 1 A LYS 77 ? A LYS 77 592 15 Y 1 A LYS 78 ? A LYS 78 593 15 Y 1 A SER 79 ? A SER 79 594 15 Y 1 A LYS 80 ? A LYS 80 595 15 Y 1 A LYS 81 ? A LYS 81 596 15 Y 1 A ASN 82 ? A ASN 82 597 15 Y 1 A LEU 83 ? A LEU 83 598 15 Y 1 A ARG 84 ? A ARG 84 599 15 Y 1 A ARG 85 ? A ARG 85 600 15 Y 1 A LEU 86 ? A LEU 86 601 16 Y 1 A GLY 1 ? A GLY 1 602 16 Y 1 A SER 2 ? A SER 2 603 16 Y 1 A GLU 3 ? A GLU 3 604 16 Y 1 A VAL 4 ? A VAL 4 605 16 Y 1 A ALA 5 ? A ALA 5 606 16 Y 1 A LYS 6 ? A LYS 6 607 16 Y 1 A THR 7 ? A THR 7 608 16 Y 1 A LEU 8 ? A LEU 8 609 16 Y 1 A LYS 9 ? A LYS 9 610 16 Y 1 A LYS 10 ? A LYS 10 611 16 Y 1 A ASN 11 ? A ASN 11 612 16 Y 1 A GLU 12 ? A GLU 12 613 16 Y 1 A SER 59 ? A SER 59 614 16 Y 1 A ASP 60 ? A ASP 60 615 16 Y 1 A GLY 61 ? A GLY 61 616 16 Y 1 A LYS 62 ? A LYS 62 617 16 Y 1 A LEU 63 ? A LEU 63 618 16 Y 1 A LEU 64 ? A LEU 64 619 16 Y 1 A LYS 65 ? A LYS 65 620 16 Y 1 A ALA 66 ? A ALA 66 621 16 Y 1 A SER 67 ? A SER 67 622 16 Y 1 A CYS 68 ? A CYS 68 623 16 Y 1 A LYS 69 ? A LYS 69 624 16 Y 1 A ILE 70 ? A ILE 70 625 16 Y 1 A GLY 71 ? A GLY 71 626 16 Y 1 A PRO 72 ? A PRO 72 627 16 Y 1 A LEU 73 ? A LEU 73 628 16 Y 1 A PRO 74 ? A PRO 74 629 16 Y 1 A GLY 75 ? A GLY 75 630 16 Y 1 A THR 76 ? A THR 76 631 16 Y 1 A LYS 77 ? A LYS 77 632 16 Y 1 A LYS 78 ? A LYS 78 633 16 Y 1 A SER 79 ? A SER 79 634 16 Y 1 A LYS 80 ? A LYS 80 635 16 Y 1 A LYS 81 ? A LYS 81 636 16 Y 1 A ASN 82 ? A ASN 82 637 16 Y 1 A LEU 83 ? A LEU 83 638 16 Y 1 A ARG 84 ? A ARG 84 639 16 Y 1 A ARG 85 ? A ARG 85 640 16 Y 1 A LEU 86 ? A LEU 86 641 17 Y 1 A GLY 1 ? A GLY 1 642 17 Y 1 A SER 2 ? A SER 2 643 17 Y 1 A GLU 3 ? A GLU 3 644 17 Y 1 A VAL 4 ? A VAL 4 645 17 Y 1 A ALA 5 ? A ALA 5 646 17 Y 1 A LYS 6 ? A LYS 6 647 17 Y 1 A THR 7 ? A THR 7 648 17 Y 1 A LEU 8 ? A LEU 8 649 17 Y 1 A LYS 9 ? A LYS 9 650 17 Y 1 A LYS 10 ? A LYS 10 651 17 Y 1 A ASN 11 ? A ASN 11 652 17 Y 1 A GLU 12 ? A GLU 12 653 17 Y 1 A SER 59 ? A SER 59 654 17 Y 1 A ASP 60 ? A ASP 60 655 17 Y 1 A GLY 61 ? A GLY 61 656 17 Y 1 A LYS 62 ? A LYS 62 657 17 Y 1 A LEU 63 ? A LEU 63 658 17 Y 1 A LEU 64 ? A LEU 64 659 17 Y 1 A LYS 65 ? A LYS 65 660 17 Y 1 A ALA 66 ? A ALA 66 661 17 Y 1 A SER 67 ? A SER 67 662 17 Y 1 A CYS 68 ? A CYS 68 663 17 Y 1 A LYS 69 ? A LYS 69 664 17 Y 1 A ILE 70 ? A ILE 70 665 17 Y 1 A GLY 71 ? A GLY 71 666 17 Y 1 A PRO 72 ? A PRO 72 667 17 Y 1 A LEU 73 ? A LEU 73 668 17 Y 1 A PRO 74 ? A PRO 74 669 17 Y 1 A GLY 75 ? A GLY 75 670 17 Y 1 A THR 76 ? A THR 76 671 17 Y 1 A LYS 77 ? A LYS 77 672 17 Y 1 A LYS 78 ? A LYS 78 673 17 Y 1 A SER 79 ? A SER 79 674 17 Y 1 A LYS 80 ? A LYS 80 675 17 Y 1 A LYS 81 ? A LYS 81 676 17 Y 1 A ASN 82 ? A ASN 82 677 17 Y 1 A LEU 83 ? A LEU 83 678 17 Y 1 A ARG 84 ? A ARG 84 679 17 Y 1 A ARG 85 ? A ARG 85 680 17 Y 1 A LEU 86 ? A LEU 86 681 18 Y 1 A GLY 1 ? A GLY 1 682 18 Y 1 A SER 2 ? A SER 2 683 18 Y 1 A GLU 3 ? A GLU 3 684 18 Y 1 A VAL 4 ? A VAL 4 685 18 Y 1 A ALA 5 ? A ALA 5 686 18 Y 1 A LYS 6 ? A LYS 6 687 18 Y 1 A THR 7 ? A THR 7 688 18 Y 1 A LEU 8 ? A LEU 8 689 18 Y 1 A LYS 9 ? A LYS 9 690 18 Y 1 A LYS 10 ? A LYS 10 691 18 Y 1 A ASN 11 ? A ASN 11 692 18 Y 1 A GLU 12 ? A GLU 12 693 18 Y 1 A SER 59 ? A SER 59 694 18 Y 1 A ASP 60 ? A ASP 60 695 18 Y 1 A GLY 61 ? A GLY 61 696 18 Y 1 A LYS 62 ? A LYS 62 697 18 Y 1 A LEU 63 ? A LEU 63 698 18 Y 1 A LEU 64 ? A LEU 64 699 18 Y 1 A LYS 65 ? A LYS 65 700 18 Y 1 A ALA 66 ? A ALA 66 701 18 Y 1 A SER 67 ? A SER 67 702 18 Y 1 A CYS 68 ? A CYS 68 703 18 Y 1 A LYS 69 ? A LYS 69 704 18 Y 1 A ILE 70 ? A ILE 70 705 18 Y 1 A GLY 71 ? A GLY 71 706 18 Y 1 A PRO 72 ? A PRO 72 707 18 Y 1 A LEU 73 ? A LEU 73 708 18 Y 1 A PRO 74 ? A PRO 74 709 18 Y 1 A GLY 75 ? A GLY 75 710 18 Y 1 A THR 76 ? A THR 76 711 18 Y 1 A LYS 77 ? A LYS 77 712 18 Y 1 A LYS 78 ? A LYS 78 713 18 Y 1 A SER 79 ? A SER 79 714 18 Y 1 A LYS 80 ? A LYS 80 715 18 Y 1 A LYS 81 ? A LYS 81 716 18 Y 1 A ASN 82 ? A ASN 82 717 18 Y 1 A LEU 83 ? A LEU 83 718 18 Y 1 A ARG 84 ? A ARG 84 719 18 Y 1 A ARG 85 ? A ARG 85 720 18 Y 1 A LEU 86 ? A LEU 86 721 19 Y 1 A GLY 1 ? A GLY 1 722 19 Y 1 A SER 2 ? A SER 2 723 19 Y 1 A GLU 3 ? A GLU 3 724 19 Y 1 A VAL 4 ? A VAL 4 725 19 Y 1 A ALA 5 ? A ALA 5 726 19 Y 1 A LYS 6 ? A LYS 6 727 19 Y 1 A THR 7 ? A THR 7 728 19 Y 1 A LEU 8 ? A LEU 8 729 19 Y 1 A LYS 9 ? A LYS 9 730 19 Y 1 A LYS 10 ? A LYS 10 731 19 Y 1 A ASN 11 ? A ASN 11 732 19 Y 1 A GLU 12 ? A GLU 12 733 19 Y 1 A SER 59 ? A SER 59 734 19 Y 1 A ASP 60 ? A ASP 60 735 19 Y 1 A GLY 61 ? A GLY 61 736 19 Y 1 A LYS 62 ? A LYS 62 737 19 Y 1 A LEU 63 ? A LEU 63 738 19 Y 1 A LEU 64 ? A LEU 64 739 19 Y 1 A LYS 65 ? A LYS 65 740 19 Y 1 A ALA 66 ? A ALA 66 741 19 Y 1 A SER 67 ? A SER 67 742 19 Y 1 A CYS 68 ? A CYS 68 743 19 Y 1 A LYS 69 ? A LYS 69 744 19 Y 1 A ILE 70 ? A ILE 70 745 19 Y 1 A GLY 71 ? A GLY 71 746 19 Y 1 A PRO 72 ? A PRO 72 747 19 Y 1 A LEU 73 ? A LEU 73 748 19 Y 1 A PRO 74 ? A PRO 74 749 19 Y 1 A GLY 75 ? A GLY 75 750 19 Y 1 A THR 76 ? A THR 76 751 19 Y 1 A LYS 77 ? A LYS 77 752 19 Y 1 A LYS 78 ? A LYS 78 753 19 Y 1 A SER 79 ? A SER 79 754 19 Y 1 A LYS 80 ? A LYS 80 755 19 Y 1 A LYS 81 ? A LYS 81 756 19 Y 1 A ASN 82 ? A ASN 82 757 19 Y 1 A LEU 83 ? A LEU 83 758 19 Y 1 A ARG 84 ? A ARG 84 759 19 Y 1 A ARG 85 ? A ARG 85 760 19 Y 1 A LEU 86 ? A LEU 86 761 20 Y 1 A GLY 1 ? A GLY 1 762 20 Y 1 A SER 2 ? A SER 2 763 20 Y 1 A GLU 3 ? A GLU 3 764 20 Y 1 A VAL 4 ? A VAL 4 765 20 Y 1 A ALA 5 ? A ALA 5 766 20 Y 1 A LYS 6 ? A LYS 6 767 20 Y 1 A THR 7 ? A THR 7 768 20 Y 1 A LEU 8 ? A LEU 8 769 20 Y 1 A LYS 9 ? A LYS 9 770 20 Y 1 A LYS 10 ? A LYS 10 771 20 Y 1 A ASN 11 ? A ASN 11 772 20 Y 1 A GLU 12 ? A GLU 12 773 20 Y 1 A SER 59 ? A SER 59 774 20 Y 1 A ASP 60 ? A ASP 60 775 20 Y 1 A GLY 61 ? A GLY 61 776 20 Y 1 A LYS 62 ? A LYS 62 777 20 Y 1 A LEU 63 ? A LEU 63 778 20 Y 1 A LEU 64 ? A LEU 64 779 20 Y 1 A LYS 65 ? A LYS 65 780 20 Y 1 A ALA 66 ? A ALA 66 781 20 Y 1 A SER 67 ? A SER 67 782 20 Y 1 A CYS 68 ? A CYS 68 783 20 Y 1 A LYS 69 ? A LYS 69 784 20 Y 1 A ILE 70 ? A ILE 70 785 20 Y 1 A GLY 71 ? A GLY 71 786 20 Y 1 A PRO 72 ? A PRO 72 787 20 Y 1 A LEU 73 ? A LEU 73 788 20 Y 1 A PRO 74 ? A PRO 74 789 20 Y 1 A GLY 75 ? A GLY 75 790 20 Y 1 A THR 76 ? A THR 76 791 20 Y 1 A LYS 77 ? A LYS 77 792 20 Y 1 A LYS 78 ? A LYS 78 793 20 Y 1 A SER 79 ? A SER 79 794 20 Y 1 A LYS 80 ? A LYS 80 795 20 Y 1 A LYS 81 ? A LYS 81 796 20 Y 1 A ASN 82 ? A ASN 82 797 20 Y 1 A LEU 83 ? A LEU 83 798 20 Y 1 A ARG 84 ? A ARG 84 799 20 Y 1 A ARG 85 ? A ARG 85 800 20 Y 1 A LEU 86 ? A LEU 86 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #