data_2M6O # _entry.id 2M6O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M6O RCSB RCSB103276 BMRB 19148 WWPDB D_1000103276 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19148 BMRB unspecified . 2M6P PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M6O _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, B.' 1 'Tabib-Salazar, A.' 2 'Doughty, P.' 3 'Lewis, R.' 4 'Ghosh, S.' 5 'Parsy, M.' 6 'Simpson, P.' 7 'Matthews, S.' 8 'Paget, M.' 9 # _citation.id primary _citation.title 'The actinobacterial transcription factor RbpA binds to the principal sigma subunit of RNA polymerase.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 41 _citation.page_first 5679 _citation.page_last 5691 _citation.year 2013 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23605043 _citation.pdbx_database_id_DOI 10.1093/nar/gkt277 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tabib-Salazar, A.' 1 primary 'Liu, B.' 2 primary 'Doughty, P.' 3 primary 'Lewis, R.A.' 4 primary 'Ghosh, S.' 5 primary 'Parsy, M.L.' 6 primary 'Simpson, P.J.' 7 primary ;O'Dwyer, K. ; 8 primary 'Matthews, S.J.' 9 primary 'Paget, M.S.' 10 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 5358.016 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QAVEYACEKGHRFEMPFSVEAEIPPEWECKVCGAQALLVDGDGPEEKK _entity_poly.pdbx_seq_one_letter_code_can QAVEYACEKGHRFEMPFSVEAEIPPEWECKVCGAQALLVDGDGPEEKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ALA n 1 3 VAL n 1 4 GLU n 1 5 TYR n 1 6 ALA n 1 7 CYS n 1 8 GLU n 1 9 LYS n 1 10 GLY n 1 11 HIS n 1 12 ARG n 1 13 PHE n 1 14 GLU n 1 15 MET n 1 16 PRO n 1 17 PHE n 1 18 SER n 1 19 VAL n 1 20 GLU n 1 21 ALA n 1 22 GLU n 1 23 ILE n 1 24 PRO n 1 25 PRO n 1 26 GLU n 1 27 TRP n 1 28 GLU n 1 29 CYS n 1 30 LYS n 1 31 VAL n 1 32 CYS n 1 33 GLY n 1 34 ALA n 1 35 GLN n 1 36 ALA n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 GLY n 1 42 ASP n 1 43 GLY n 1 44 PRO n 1 45 GLU n 1 46 GLU n 1 47 LYS n 1 48 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SCO1421 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-471 / A3(2) / M145' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pSET152 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9RKY0_STRCO _struct_ref.pdbx_db_accession Q9RKY0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QAVEYACEKGHRFEMPFSVEAEIPPEWECKVCGAQALLVDGDGPEEKK _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M6O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 48 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RKY0 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 28 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.5 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '3 mM beta-mercaptoethanol, 500 mM sodium chloride, 20 mM TRIS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M6O _pdbx_nmr_refine.method 'simulated annealing, distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M6O _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M6O _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M6O _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M6O _struct.title 'The actinobacterial transcription factor RbpA binds to the principal sigma subunit of RNA polymerase' _struct.pdbx_descriptor 'Uncharacterized protein' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M6O _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'RbpA, RNAP, Sigma factor, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 12 ? MET A 15 ? ARG A 39 MET A 42 A 2 VAL A 3 ? CYS A 7 ? VAL A 30 CYS A 34 A 3 GLN A 35 ? VAL A 39 ? GLN A 62 VAL A 66 A 4 GLU A 26 ? GLU A 28 ? GLU A 53 GLU A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 13 ? O PHE A 40 N TYR A 5 ? N TYR A 32 A 2 3 N ALA A 6 ? N ALA A 33 O LEU A 37 ? O LEU A 64 A 3 4 O ALA A 36 ? O ALA A 63 N TRP A 27 ? N TRP A 54 # _atom_sites.entry_id 2M6O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 28 28 GLN GLN A . n A 1 2 ALA 2 29 29 ALA ALA A . n A 1 3 VAL 3 30 30 VAL VAL A . n A 1 4 GLU 4 31 31 GLU GLU A . n A 1 5 TYR 5 32 32 TYR TYR A . n A 1 6 ALA 6 33 33 ALA ALA A . n A 1 7 CYS 7 34 34 CYS CYS A . n A 1 8 GLU 8 35 35 GLU GLU A . n A 1 9 LYS 9 36 36 LYS LYS A . n A 1 10 GLY 10 37 37 GLY GLY A . n A 1 11 HIS 11 38 38 HIS HIS A . n A 1 12 ARG 12 39 39 ARG ARG A . n A 1 13 PHE 13 40 40 PHE PHE A . n A 1 14 GLU 14 41 41 GLU GLU A . n A 1 15 MET 15 42 42 MET MET A . n A 1 16 PRO 16 43 43 PRO PRO A . n A 1 17 PHE 17 44 44 PHE PHE A . n A 1 18 SER 18 45 45 SER SER A . n A 1 19 VAL 19 46 46 VAL VAL A . n A 1 20 GLU 20 47 47 GLU GLU A . n A 1 21 ALA 21 48 48 ALA ALA A . n A 1 22 GLU 22 49 49 GLU GLU A . n A 1 23 ILE 23 50 50 ILE ILE A . n A 1 24 PRO 24 51 51 PRO PRO A . n A 1 25 PRO 25 52 52 PRO PRO A . n A 1 26 GLU 26 53 53 GLU GLU A . n A 1 27 TRP 27 54 54 TRP TRP A . n A 1 28 GLU 28 55 55 GLU GLU A . n A 1 29 CYS 29 56 56 CYS CYS A . n A 1 30 LYS 30 57 57 LYS LYS A . n A 1 31 VAL 31 58 58 VAL VAL A . n A 1 32 CYS 32 59 59 CYS CYS A . n A 1 33 GLY 33 60 60 GLY GLY A . n A 1 34 ALA 34 61 61 ALA ALA A . n A 1 35 GLN 35 62 62 GLN GLN A . n A 1 36 ALA 36 63 63 ALA ALA A . n A 1 37 LEU 37 64 64 LEU LEU A . n A 1 38 LEU 38 65 65 LEU LEU A . n A 1 39 VAL 39 66 66 VAL VAL A . n A 1 40 ASP 40 67 67 ASP ASP A . n A 1 41 GLY 41 68 68 GLY GLY A . n A 1 42 ASP 42 69 69 ASP ASP A . n A 1 43 GLY 43 70 70 GLY GLY A . n A 1 44 PRO 44 71 71 PRO PRO A . n A 1 45 GLU 45 72 72 GLU GLU A . n A 1 46 GLU 46 73 73 GLU GLU A . n A 1 47 LYS 47 74 74 LYS LYS A . n A 1 48 LYS 48 75 75 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-08 2 'Structure model' 1 1 2013-06-26 3 'Structure model' 1 2 2013-07-03 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category audit_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_audit_author.name' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id beta-mercaptoethanol-1 3 ? mM ? 1 'sodium chloride-2' 500 ? mM ? 1 TRIS-3 20 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 H2 A GLN 28 ? ? OE1 A GLU 73 ? ? 1.59 2 5 OE1 A GLU 55 ? ? HZ2 A LYS 57 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 61 ? ? -178.75 -177.70 2 2 VAL A 58 ? ? -98.85 -60.71 3 2 ASP A 67 ? ? 63.66 83.55 4 2 ASP A 69 ? ? 69.71 -60.76 5 2 LYS A 74 ? ? -149.99 -36.70 6 3 ALA A 61 ? ? -165.85 -168.69 7 3 ASP A 67 ? ? 59.07 102.56 8 4 PRO A 52 ? ? -58.90 -8.99 9 4 ALA A 61 ? ? -172.99 -166.04 10 4 LYS A 74 ? ? -136.36 -54.74 11 5 VAL A 58 ? ? -97.78 -60.37 12 5 ASP A 67 ? ? 67.97 90.11 13 5 GLU A 73 ? ? 72.13 -41.03 14 6 ASP A 67 ? ? 64.06 80.90 15 7 ASP A 69 ? ? -66.94 85.28 16 8 ASP A 69 ? ? -168.19 -61.04 17 9 ALA A 61 ? ? -171.61 -167.42 18 9 ASP A 67 ? ? 66.64 93.61 19 10 ASP A 67 ? ? 63.20 73.41 20 10 ASP A 69 ? ? 71.54 -41.65 21 10 GLU A 73 ? ? 61.92 82.19 22 10 LYS A 74 ? ? -147.91 -26.17 #