data_2M6T # _entry.id 2M6T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M6T pdb_00002m6t 10.2210/pdb2m6t/pdb RCSB RCSB103281 ? ? BMRB 19153 ? 10.13018/BMR19153 WWPDB D_1000103281 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-15 2 'Structure model' 1 1 2016-05-04 3 'Structure model' 1 2 2016-05-18 4 'Structure model' 1 3 2016-06-01 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_entry_details 5 5 'Structure model' pdbx_modification_feature 6 5 'Structure model' pdbx_nmr_software 7 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M6T _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2CNJ PDB . unspecified 2M68 PDB . unspecified 19153 BMRB . unspecified 2M6O PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Strickland, M.' 1 'Williams, C.' 2 'Richards, E.' 3 'Minnall, L.' 4 'Crump, M.P.' 5 'Frago, S.' 6 'Hughes, J.' 7 'Garner, L.' 8 'Hoppe, H.' 9 'Rezgui, D.' 10 'Zaccheo, O.J.' 11 'Prince, S.N.' 12 'Hassan, A.B.' 13 'Whittaker, S.' 14 # _citation.id primary _citation.title 'Functional evolution of IGF2:IGF2R domain 11 binding generates novel structural interactions and a specific IGF2 antagonist.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 113 _citation.page_first E2766 _citation.page_last E2775 _citation.year 2016 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27140600 _citation.pdbx_database_id_DOI 10.1073/pnas.1513023113 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Frago, S.' 1 ? primary 'Nicholls, R.D.' 2 ? primary 'Strickland, M.' 3 ? primary 'Hughes, J.' 4 ? primary 'Williams, C.' 5 ? primary 'Garner, L.' 6 ? primary 'Surakhy, M.' 7 ? primary 'Maclean, R.' 8 ? primary 'Rezgui, D.' 9 ? primary 'Prince, S.N.' 10 ? primary 'Zaccheo, O.J.' 11 ? primary 'Ebner, D.' 12 ? primary 'Sanegre, S.' 13 ? primary 'Yu, S.' 14 ? primary 'Buffa, F.M.' 15 ? primary 'Crump, M.P.' 16 ? primary 'Hassan, A.B.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Insulin-like growth factor 2 receptor variant' _entity.formula_weight 15433.587 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'Q1571L ,S1466A, G1467K, K1468G, G1469W, L1470G' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 ASN n 1 5 GLU n 1 6 HIS n 1 7 ASP n 1 8 ASP n 1 9 CYS n 1 10 GLN n 1 11 VAL n 1 12 THR n 1 13 ASN n 1 14 PRO n 1 15 SER n 1 16 THR n 1 17 GLY n 1 18 HIS n 1 19 LEU n 1 20 PHE n 1 21 ASP n 1 22 LEU n 1 23 SER n 1 24 SER n 1 25 LEU n 1 26 SER n 1 27 GLY n 1 28 ARG n 1 29 ALA n 1 30 GLY n 1 31 PHE n 1 32 THR n 1 33 ALA n 1 34 ALA n 1 35 TYR n 1 36 ALA n 1 37 LYS n 1 38 GLY n 1 39 TRP n 1 40 GLY n 1 41 VAL n 1 42 TYR n 1 43 MET n 1 44 SER n 1 45 ILE n 1 46 CYS n 1 47 GLY n 1 48 GLU n 1 49 ASN n 1 50 GLU n 1 51 ASN n 1 52 CYS n 1 53 PRO n 1 54 PRO n 1 55 GLY n 1 56 VAL n 1 57 GLY n 1 58 ALA n 1 59 CYS n 1 60 PHE n 1 61 GLY n 1 62 GLN n 1 63 THR n 1 64 ARG n 1 65 ILE n 1 66 SER n 1 67 VAL n 1 68 GLY n 1 69 LYS n 1 70 ALA n 1 71 ASN n 1 72 LYS n 1 73 ARG n 1 74 LEU n 1 75 ARG n 1 76 TYR n 1 77 VAL n 1 78 ASP n 1 79 GLN n 1 80 VAL n 1 81 LEU n 1 82 GLN n 1 83 LEU n 1 84 VAL n 1 85 TYR n 1 86 LYS n 1 87 ASP n 1 88 GLY n 1 89 SER n 1 90 PRO n 1 91 CYS n 1 92 PRO n 1 93 SER n 1 94 LYS n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 SER n 1 99 TYR n 1 100 LYS n 1 101 SER n 1 102 VAL n 1 103 ILE n 1 104 SER n 1 105 PHE n 1 106 VAL n 1 107 CYS n 1 108 ARG n 1 109 PRO n 1 110 GLU n 1 111 ALA n 1 112 GLY n 1 113 PRO n 1 114 THR n 1 115 ASN n 1 116 ARG n 1 117 PRO n 1 118 MET n 1 119 LEU n 1 120 ILE n 1 121 SER n 1 122 LEU n 1 123 ASP n 1 124 LYS n 1 125 GLN n 1 126 THR n 1 127 CYS n 1 128 THR n 1 129 LEU n 1 130 PHE n 1 131 PHE n 1 132 SER n 1 133 TRP n 1 134 HIS n 1 135 THR n 1 136 PRO n 1 137 LEU n 1 138 ALA n 1 139 CYS n 1 140 GLU n 1 141 LEU n 1 142 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET26a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1508 1508 MET MET A . n A 1 2 LYS 2 1509 1509 LYS LYS A . n A 1 3 SER 3 1510 1510 SER SER A . n A 1 4 ASN 4 1511 1511 ASN ASN A . n A 1 5 GLU 5 1512 1512 GLU GLU A . n A 1 6 HIS 6 1513 1513 HIS HIS A . n A 1 7 ASP 7 1514 1514 ASP ASP A . n A 1 8 ASP 8 1515 1515 ASP ASP A . n A 1 9 CYS 9 1516 1516 CYS CYS A . n A 1 10 GLN 10 1517 1517 GLN GLN A . n A 1 11 VAL 11 1518 1518 VAL VAL A . n A 1 12 THR 12 1519 1519 THR THR A . n A 1 13 ASN 13 1520 1520 ASN ASN A . n A 1 14 PRO 14 1521 1521 PRO PRO A . n A 1 15 SER 15 1522 1522 SER SER A . n A 1 16 THR 16 1523 1523 THR THR A . n A 1 17 GLY 17 1524 1524 GLY GLY A . n A 1 18 HIS 18 1525 1525 HIS HIS A . n A 1 19 LEU 19 1526 1526 LEU LEU A . n A 1 20 PHE 20 1527 1527 PHE PHE A . n A 1 21 ASP 21 1528 1528 ASP ASP A . n A 1 22 LEU 22 1529 1529 LEU LEU A . n A 1 23 SER 23 1530 1530 SER SER A . n A 1 24 SER 24 1531 1531 SER SER A . n A 1 25 LEU 25 1532 1532 LEU LEU A . n A 1 26 SER 26 1533 1533 SER SER A . n A 1 27 GLY 27 1534 1534 GLY GLY A . n A 1 28 ARG 28 1535 1535 ARG ARG A . n A 1 29 ALA 29 1536 1536 ALA ALA A . n A 1 30 GLY 30 1537 1537 GLY GLY A . n A 1 31 PHE 31 1538 1538 PHE PHE A . n A 1 32 THR 32 1539 1539 THR THR A . n A 1 33 ALA 33 1540 1540 ALA ALA A . n A 1 34 ALA 34 1541 1541 ALA ALA A . n A 1 35 TYR 35 1542 1542 TYR TYR A . n A 1 36 ALA 36 1543 1543 ALA ALA A . n A 1 37 LYS 37 1544 1544 LYS LYS A . n A 1 38 GLY 38 1545 1545 GLY GLY A . n A 1 39 TRP 39 1546 1546 TRP TRP A . n A 1 40 GLY 40 1547 1547 GLY GLY A . n A 1 41 VAL 41 1548 1548 VAL VAL A . n A 1 42 TYR 42 1549 1549 TYR TYR A . n A 1 43 MET 43 1550 1550 MET MET A . n A 1 44 SER 44 1551 1551 SER SER A . n A 1 45 ILE 45 1552 1552 ILE ILE A . n A 1 46 CYS 46 1553 1553 CYS CYS A . n A 1 47 GLY 47 1554 1554 GLY GLY A . n A 1 48 GLU 48 1555 1555 GLU GLU A . n A 1 49 ASN 49 1556 1556 ASN ASN A . n A 1 50 GLU 50 1557 1557 GLU GLU A . n A 1 51 ASN 51 1558 1558 ASN ASN A . n A 1 52 CYS 52 1559 1559 CYS CYS A . n A 1 53 PRO 53 1560 1560 PRO PRO A . n A 1 54 PRO 54 1561 1561 PRO PRO A . n A 1 55 GLY 55 1562 1562 GLY GLY A . n A 1 56 VAL 56 1563 1563 VAL VAL A . n A 1 57 GLY 57 1564 1564 GLY GLY A . n A 1 58 ALA 58 1565 1565 ALA ALA A . n A 1 59 CYS 59 1566 1566 CYS CYS A . n A 1 60 PHE 60 1567 1567 PHE PHE A . n A 1 61 GLY 61 1568 1568 GLY GLY A . n A 1 62 GLN 62 1569 1569 GLN GLN A . n A 1 63 THR 63 1570 1570 THR THR A . n A 1 64 ARG 64 1571 1571 ARG ARG A . n A 1 65 ILE 65 1572 1572 ILE ILE A . n A 1 66 SER 66 1573 1573 SER SER A . n A 1 67 VAL 67 1574 1574 VAL VAL A . n A 1 68 GLY 68 1575 1575 GLY GLY A . n A 1 69 LYS 69 1576 1576 LYS LYS A . n A 1 70 ALA 70 1577 1577 ALA ALA A . n A 1 71 ASN 71 1578 1578 ASN ASN A . n A 1 72 LYS 72 1579 1579 LYS LYS A . n A 1 73 ARG 73 1580 1580 ARG ARG A . n A 1 74 LEU 74 1581 1581 LEU LEU A . n A 1 75 ARG 75 1582 1582 ARG ARG A . n A 1 76 TYR 76 1583 1583 TYR TYR A . n A 1 77 VAL 77 1584 1584 VAL VAL A . n A 1 78 ASP 78 1585 1585 ASP ASP A . n A 1 79 GLN 79 1586 1586 GLN GLN A . n A 1 80 VAL 80 1587 1587 VAL VAL A . n A 1 81 LEU 81 1588 1588 LEU LEU A . n A 1 82 GLN 82 1589 1589 GLN GLN A . n A 1 83 LEU 83 1590 1590 LEU LEU A . n A 1 84 VAL 84 1591 1591 VAL VAL A . n A 1 85 TYR 85 1592 1592 TYR TYR A . n A 1 86 LYS 86 1593 1593 LYS LYS A . n A 1 87 ASP 87 1594 1594 ASP ASP A . n A 1 88 GLY 88 1595 1595 GLY GLY A . n A 1 89 SER 89 1596 1596 SER SER A . n A 1 90 PRO 90 1597 1597 PRO PRO A . n A 1 91 CYS 91 1598 1598 CYS CYS A . n A 1 92 PRO 92 1599 1599 PRO PRO A . n A 1 93 SER 93 1600 1600 SER SER A . n A 1 94 LYS 94 1601 1601 LYS LYS A . n A 1 95 SER 95 1602 1602 SER SER A . n A 1 96 GLY 96 1603 1603 GLY GLY A . n A 1 97 LEU 97 1604 1604 LEU LEU A . n A 1 98 SER 98 1605 1605 SER SER A . n A 1 99 TYR 99 1606 1606 TYR TYR A . n A 1 100 LYS 100 1607 1607 LYS LYS A . n A 1 101 SER 101 1608 1608 SER SER A . n A 1 102 VAL 102 1609 1609 VAL VAL A . n A 1 103 ILE 103 1610 1610 ILE ILE A . n A 1 104 SER 104 1611 1611 SER SER A . n A 1 105 PHE 105 1612 1612 PHE PHE A . n A 1 106 VAL 106 1613 1613 VAL VAL A . n A 1 107 CYS 107 1614 1614 CYS CYS A . n A 1 108 ARG 108 1615 1615 ARG ARG A . n A 1 109 PRO 109 1616 1616 PRO PRO A . n A 1 110 GLU 110 1617 1617 GLU GLU A . n A 1 111 ALA 111 1618 1618 ALA ALA A . n A 1 112 GLY 112 1619 1619 GLY GLY A . n A 1 113 PRO 113 1620 1620 PRO PRO A . n A 1 114 THR 114 1621 1621 THR THR A . n A 1 115 ASN 115 1622 1622 ASN ASN A . n A 1 116 ARG 116 1623 1623 ARG ARG A . n A 1 117 PRO 117 1624 1624 PRO PRO A . n A 1 118 MET 118 1625 1625 MET MET A . n A 1 119 LEU 119 1626 1626 LEU LEU A . n A 1 120 ILE 120 1627 1627 ILE ILE A . n A 1 121 SER 121 1628 1628 SER SER A . n A 1 122 LEU 122 1629 1629 LEU LEU A . n A 1 123 ASP 123 1630 1630 ASP ASP A . n A 1 124 LYS 124 1631 1631 LYS LYS A . n A 1 125 GLN 125 1632 1632 GLN GLN A . n A 1 126 THR 126 1633 1633 THR THR A . n A 1 127 CYS 127 1634 1634 CYS CYS A . n A 1 128 THR 128 1635 1635 THR THR A . n A 1 129 LEU 129 1636 1636 LEU LEU A . n A 1 130 PHE 130 1637 1637 PHE PHE A . n A 1 131 PHE 131 1638 1638 PHE PHE A . n A 1 132 SER 132 1639 1639 SER SER A . n A 1 133 TRP 133 1640 1640 TRP TRP A . n A 1 134 HIS 134 1641 1641 HIS HIS A . n A 1 135 THR 135 1642 1642 THR THR A . n A 1 136 PRO 136 1643 1643 PRO PRO A . n A 1 137 LEU 137 1644 1644 LEU LEU A . n A 1 138 ALA 138 1645 1645 ALA ALA A . n A 1 139 CYS 139 1646 1646 CYS CYS A . n A 1 140 GLU 140 1647 1647 GLU GLU A . n A 1 141 LEU 141 1648 1648 LEU LEU A . n A 1 142 ALA 142 1649 1649 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR solution structure ensemble of human domain 11 IGF2R mutated five times in the AB loop' _exptl.entry_id 2M6T _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M6T _struct.title 'NMR solution structure ensemble of 3-4D mutant domain 11 IGF2R' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M6T _struct_keywords.pdbx_keywords 'ANTITUMOR PROTEIN' _struct_keywords.text 'antitumor, directed evolution and high affinity, ANTITUMOR PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q59EZ3_HUMAN _struct_ref.pdbx_db_accession Q59EZ3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQA ; _struct_ref.pdbx_align_begin 1431 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M6T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q59EZ3 _struct_ref_seq.db_align_beg 1431 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1572 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1508 _struct_ref_seq.pdbx_auth_seq_align_end 1649 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M6T ALA A 36 ? UNP Q59EZ3 SER 1466 'engineered mutation' 1543 1 1 2M6T LYS A 37 ? UNP Q59EZ3 GLU 1467 'engineered mutation' 1544 2 1 2M6T GLY A 38 ? UNP Q59EZ3 LYS 1468 'engineered mutation' 1545 3 1 2M6T TRP A 39 ? UNP Q59EZ3 GLY 1469 'engineered mutation' 1546 4 1 2M6T GLY A 40 ? UNP Q59EZ3 LEU 1470 'engineered mutation' 1547 5 1 2M6T LEU A 141 ? UNP Q59EZ3 GLN 1571 'engineered mutation' 1648 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 23 ? SER A 26 ? SER A 1530 SER A 1533 5 ? 4 HELX_P HELX_P2 2 PRO A 136 ? CYS A 139 ? PRO A 1643 CYS A 1646 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 1516 A CYS 1553 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 52 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 1559 A CYS 1566 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 91 SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 1598 A CYS 1634 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 139 SG ? ? A CYS 1614 A CYS 1646 1_555 ? ? ? ? ? ? ? 2.025 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 9 ? CYS A 46 ? CYS A 1516 ? 1_555 CYS A 1553 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 52 ? CYS A 59 ? CYS A 1559 ? 1_555 CYS A 1566 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 91 ? CYS A 127 ? CYS A 1598 ? 1_555 CYS A 1634 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 107 ? CYS A 139 ? CYS A 1614 ? 1_555 CYS A 1646 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? C ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? parallel C 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 10 ? THR A 12 ? GLN A 1517 THR A 1519 A 2 LEU A 19 ? ASP A 21 ? LEU A 1526 ASP A 1528 B 1 PHE A 31 ? ALA A 34 ? PHE A 1538 ALA A 1541 B 2 GLY A 40 ? MET A 43 ? GLY A 1547 MET A 1550 B 3 ALA A 58 ? PHE A 60 ? ALA A 1565 PHE A 1567 B 4 ILE A 65 ? SER A 66 ? ILE A 1572 SER A 1573 C 1 LEU A 74 ? VAL A 77 ? LEU A 1581 VAL A 1584 C 2 VAL A 80 ? TYR A 85 ? VAL A 1587 TYR A 1592 C 3 LYS A 100 ? CYS A 107 ? LYS A 1607 CYS A 1614 C 4 THR A 128 ? THR A 135 ? THR A 1635 THR A 1642 C 5 PRO A 117 ? ASP A 123 ? PRO A 1624 ASP A 1630 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 11 ? N VAL A 1518 O PHE A 20 ? O PHE A 1527 B 1 2 N PHE A 31 ? N PHE A 1538 O MET A 43 ? O MET A 1550 B 2 3 N TYR A 42 ? N TYR A 1549 O CYS A 59 ? O CYS A 1566 B 3 4 N PHE A 60 ? N PHE A 1567 O ILE A 65 ? O ILE A 1572 C 1 2 N ARG A 75 ? N ARG A 1582 O GLN A 82 ? O GLN A 1589 C 2 3 N LEU A 81 ? N LEU A 1588 O PHE A 105 ? O PHE A 1612 C 3 4 N SER A 104 ? N SER A 1611 O PHE A 131 ? O PHE A 1638 C 4 5 O SER A 132 ? O SER A 1639 N MET A 118 ? N MET A 1625 # _pdbx_entry_details.entry_id 2M6T _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OD1 A ASP 1630 ? ? HG1 A THR 1633 ? ? 1.60 2 20 OD1 A ASP 1528 ? ? HG A SER 1530 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 1510 ? ? -146.63 37.60 2 1 HIS A 1513 ? ? -112.67 77.04 3 1 ALA A 1543 ? ? -66.94 84.08 4 1 LYS A 1544 ? ? 174.07 -28.32 5 1 CYS A 1553 ? ? 64.85 81.68 6 1 PRO A 1561 ? ? -47.54 104.16 7 1 ASP A 1594 ? ? 57.60 80.72 8 1 GLU A 1617 ? ? -88.24 40.26 9 1 ASN A 1622 ? ? -83.53 37.55 10 2 ASN A 1511 ? ? 72.99 45.97 11 2 CYS A 1516 ? ? 62.55 62.06 12 2 ALA A 1543 ? ? -83.62 49.69 13 2 CYS A 1553 ? ? 72.33 94.92 14 2 ALA A 1577 ? ? -67.48 86.14 15 2 LYS A 1601 ? ? -160.04 101.76 16 2 ALA A 1618 ? ? 66.19 175.13 17 2 CYS A 1634 ? ? 63.67 63.84 18 3 ASN A 1511 ? ? -162.20 38.93 19 3 HIS A 1513 ? ? -159.92 64.22 20 3 ASP A 1515 ? ? -107.21 44.27 21 3 CYS A 1553 ? ? 71.92 81.76 22 3 PRO A 1561 ? ? -55.10 99.73 23 3 LYS A 1601 ? ? 73.10 -62.72 24 3 SER A 1605 ? ? -177.41 123.78 25 3 GLU A 1617 ? ? -100.12 42.05 26 3 ASN A 1622 ? ? -84.36 30.15 27 4 LYS A 1509 ? ? -170.03 -48.01 28 4 GLU A 1512 ? ? -149.84 35.31 29 4 HIS A 1513 ? ? -116.74 67.44 30 4 ASP A 1515 ? ? -82.77 46.83 31 4 CYS A 1553 ? ? 68.41 76.79 32 4 PRO A 1561 ? ? -59.17 103.21 33 4 ASP A 1594 ? ? 65.60 87.75 34 4 ALA A 1618 ? ? 68.18 -71.56 35 4 ASN A 1622 ? ? -88.04 46.30 36 5 ASN A 1511 ? ? -105.63 43.88 37 5 ASP A 1514 ? ? 63.39 64.77 38 5 ASP A 1515 ? ? -128.42 -67.80 39 5 LYS A 1544 ? ? 68.06 -46.46 40 5 PRO A 1561 ? ? -55.83 100.06 41 5 ASP A 1594 ? ? 65.33 93.37 42 5 GLU A 1617 ? ? -88.48 41.19 43 6 ASP A 1514 ? ? -149.50 25.97 44 6 ALA A 1543 ? ? 65.15 -90.03 45 6 LYS A 1544 ? ? -145.35 -62.64 46 6 CYS A 1553 ? ? 63.48 68.98 47 6 PRO A 1561 ? ? -51.21 107.07 48 6 ALA A 1577 ? ? -62.54 86.32 49 6 ASP A 1594 ? ? 62.51 87.46 50 6 PRO A 1599 ? ? -69.47 4.33 51 6 LYS A 1601 ? ? 70.84 -57.17 52 6 SER A 1605 ? ? 168.36 119.74 53 6 ASN A 1622 ? ? -54.98 109.78 54 7 PRO A 1561 ? ? -50.33 101.41 55 7 ASP A 1594 ? ? 61.53 60.37 56 7 GLU A 1617 ? ? -87.89 42.20 57 7 ASN A 1622 ? ? -84.89 40.84 58 8 ALA A 1543 ? ? -74.58 35.45 59 8 CYS A 1553 ? ? 74.97 91.89 60 8 PRO A 1561 ? ? -50.44 104.24 61 8 ASP A 1594 ? ? 68.60 88.83 62 8 ASN A 1622 ? ? -83.68 49.33 63 9 SER A 1510 ? ? -146.43 35.82 64 9 ASP A 1514 ? ? -108.02 48.14 65 9 ASP A 1515 ? ? -103.67 53.29 66 9 LYS A 1544 ? ? 67.84 -52.15 67 9 CYS A 1553 ? ? 70.18 61.25 68 9 ASP A 1594 ? ? 70.62 75.73 69 9 CYS A 1614 ? ? -56.13 99.51 70 9 GLU A 1617 ? ? -80.60 41.59 71 9 ALA A 1618 ? ? -66.53 -179.42 72 10 LYS A 1544 ? ? -144.21 22.47 73 10 CYS A 1553 ? ? 67.71 67.02 74 10 PRO A 1561 ? ? -59.89 99.79 75 10 LYS A 1601 ? ? 72.88 -44.31 76 10 SER A 1605 ? ? 174.59 134.15 77 10 ALA A 1618 ? ? 60.52 -160.20 78 10 ASN A 1622 ? ? 60.24 76.10 79 11 LYS A 1544 ? ? 72.99 -38.86 80 11 LYS A 1601 ? ? 69.30 -69.60 81 11 SER A 1605 ? ? 80.52 124.86 82 11 ALA A 1618 ? ? 64.83 -169.64 83 11 ASN A 1622 ? ? 47.13 80.34 84 12 SER A 1510 ? ? -149.51 52.95 85 12 ASP A 1514 ? ? 62.40 86.19 86 12 ASP A 1515 ? ? -110.17 53.51 87 12 LYS A 1544 ? ? 59.15 15.52 88 12 CYS A 1553 ? ? 73.73 55.32 89 12 ALA A 1577 ? ? -61.49 96.11 90 12 ASP A 1594 ? ? 68.69 88.71 91 12 CYS A 1614 ? ? -60.47 94.40 92 12 ALA A 1618 ? ? 64.84 -166.07 93 12 PRO A 1620 ? ? -5.84 -62.51 94 13 LYS A 1509 ? ? -89.86 46.82 95 13 ASP A 1514 ? ? -139.24 -45.25 96 13 ASP A 1515 ? ? -107.98 47.74 97 13 CYS A 1516 ? ? 64.39 61.80 98 13 LYS A 1544 ? ? -173.61 -39.40 99 13 CYS A 1553 ? ? 62.51 67.39 100 13 PRO A 1561 ? ? -57.13 107.49 101 13 GLN A 1586 ? ? 69.05 -1.23 102 13 GLU A 1617 ? ? -101.03 41.54 103 14 PRO A 1561 ? ? -39.22 114.17 104 14 ALA A 1577 ? ? -67.38 79.27 105 14 LYS A 1579 ? ? -146.01 33.35 106 14 ASP A 1594 ? ? 68.44 92.89 107 14 GLU A 1617 ? ? -75.21 41.36 108 15 LYS A 1544 ? ? 50.71 75.03 109 15 TRP A 1546 ? ? -100.09 72.56 110 15 CYS A 1553 ? ? 66.28 61.46 111 15 ALA A 1577 ? ? -61.32 89.63 112 15 ASP A 1594 ? ? 70.21 45.90 113 15 ALA A 1618 ? ? 61.53 -158.27 114 15 ASN A 1622 ? ? -90.41 45.74 115 16 LYS A 1509 ? ? -128.14 -53.33 116 16 SER A 1510 ? ? -150.22 82.01 117 16 ASP A 1514 ? ? -161.73 81.11 118 16 LYS A 1544 ? ? -177.75 -44.03 119 16 ALA A 1577 ? ? -59.02 105.57 120 16 CYS A 1614 ? ? -63.27 98.83 121 16 ALA A 1618 ? ? 45.84 86.55 122 17 HIS A 1513 ? ? 179.12 128.45 123 17 ASP A 1515 ? ? -109.00 54.02 124 17 LYS A 1544 ? ? 69.26 -51.15 125 17 CYS A 1553 ? ? 72.54 92.23 126 17 GLU A 1617 ? ? -83.45 41.58 127 17 PRO A 1620 ? ? -69.80 1.99 128 18 ALA A 1543 ? ? 67.39 -78.51 129 18 LYS A 1544 ? ? 178.98 125.63 130 18 PRO A 1561 ? ? -59.79 104.84 131 18 ASP A 1594 ? ? 68.76 112.43 132 18 LYS A 1601 ? ? 71.51 -61.98 133 18 SER A 1605 ? ? -167.41 119.85 134 18 PRO A 1620 ? ? -76.78 39.18 135 18 ASN A 1622 ? ? -101.20 52.59 136 19 LYS A 1509 ? ? -147.47 -75.32 137 19 CYS A 1553 ? ? 70.21 37.63 138 19 PRO A 1561 ? ? -56.62 104.50 139 19 GLU A 1617 ? ? -80.35 42.13 140 20 ASP A 1515 ? ? -61.98 55.77 141 20 CYS A 1553 ? ? 72.33 52.32 142 20 PRO A 1561 ? ? -51.32 99.73 143 20 ALA A 1577 ? ? -62.14 87.90 144 20 ARG A 1580 ? ? -67.61 93.87 145 20 LYS A 1601 ? ? 65.16 -61.40 146 20 SER A 1605 ? ? -178.33 124.30 147 20 ALA A 1618 ? ? 61.09 -173.47 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 3 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 1580 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.093 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M6T _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.1 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 5 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.5 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0068 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.00139 _pdbx_nmr_ensemble_rms.entry_id 2M6T _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M6T _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-95% 13C; U-95% 15N] Domain 11, 7 % [U-2H] D2O, 93 % H2O, 100 uM sodium azide, 1 mM EDTA, 10 mM sodium acetate, 93% H2O/7% D2O ; 1 '93% H2O/7% D2O' '1 mM [U-95% 15N] Domain 11, 7 % [U-2H] D2O, 93 % H2O, 100 uM sodium azide, 1 mM EDTA, 10 mM sodium acetate, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Domain 11-1' 1 ? mM '[U-95% 13C; U-95% 15N]' 1 D2O-2 7 ? % '[U-2H]' 1 H2O-3 93 ? % ? 1 'sodium azide-4' 100 ? uM ? 1 EDTA-5 1 ? mM ? 1 'sodium acetate-6' 10 ? mM ? 1 'Domain 11-7' 1 ? mM '[U-95% 15N]' 2 D2O-8 7 ? % '[U-2H]' 2 H2O-9 93 ? % ? 2 'sodium azide-10' 100 ? uM ? 2 EDTA-11 1 ? mM ? 2 'sodium acetate-12' 10 ? mM ? 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 5.5 ambient ? 310 K 2 ? 5.5 1 atm 298 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCA' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-15N TOCSY' 1 12 1 '3D 1H-13C NOESY aliphatic' 2 13 2 'Heteronuclear NOE ratio' 2 14 2 'Heteronuclear NOE ratio' 2 15 2 'T1 experiments' 2 16 2 'T1 experiments' 2 17 2 'T2 experiments' 2 18 2 'T2 experiments' 1 19 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M6T _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 50 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2118 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 871 _pdbx_nmr_constraints.NOE_long_range_total_count 446 _pdbx_nmr_constraints.NOE_medium_range_total_count 41 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 548 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2M6T _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; processing ARIA 2.2 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.2 2 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.2 3 Doreleijers refinement CING iCing 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 6 Palmer 'data analysis' relax 1.3.9 7 Palmer processing relax 1.3.9 8 Goddard 'data analysis' Sparky 2.6 9 Varian collection VnmrJ 0.4 10 CCPN 'chemical shift assignment' CCPN_Analysis 2.1 11 CCPN 'data analysis' CCPN_Analysis 2.1 12 CCPN 'peak picking' CCPN_Analysis 2.1 13 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS TALOS+ 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian VNMRS 1 'Varian VNMRS' 900 Varian VNMRS 2 'Varian VNMRS' # _atom_sites.entry_id 2M6T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #