data_2M7F # _entry.id 2M7F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M7F RCSB RCSB103303 BMRB 19211 WWPDB D_1000103303 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 19211 BMRB . unspecified 2PJI PDB . unspecified 2M75 PDB . unspecified 2M7H PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M7F _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-04-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chuang, W.' 1 'Chang, Y.' 2 # _citation.id primary _citation.title ;The C-terminal Region of Disintegrin Modulate its 3D Conformation and Cooperate with RGD Loop in Regulating Recognitions of Integrins ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chuang, W.' 1 primary 'Chang, Y.' 2 primary 'Shiu, J.' 3 primary 'Chen, C.' 4 primary 'Chen, Y.' 5 # _cell.entry_id 2M7F _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M7F _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Zinc metalloproteinase/disintegrin' _entity.formula_weight 8695.713 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.24.- _entity.pdbx_mutation P48A,M52W,P53N,Y67N,H68G,S69L,H70Y,A71G _entity.pdbx_fragment 'UNP residues 408-478' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Snake venom metalloproteinase rhodostoxin, SVMP, Hemorrhagic protein, Disintegrin rhodostomin, RHO, Disintegrin kistrin, Platelet aggregation activation inhibitor ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EFHHHHHHGKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQSADCPRNGLYG _entity_poly.pdbx_seq_one_letter_code_can EFHHHHHHGKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQSADCPRNGLYG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 GLY n 1 10 LYS n 1 11 GLU n 1 12 CYS n 1 13 ASP n 1 14 CYS n 1 15 SER n 1 16 SER n 1 17 PRO n 1 18 GLU n 1 19 ASN n 1 20 PRO n 1 21 CYS n 1 22 CYS n 1 23 ASP n 1 24 ALA n 1 25 ALA n 1 26 THR n 1 27 CYS n 1 28 LYS n 1 29 LEU n 1 30 ARG n 1 31 PRO n 1 32 GLY n 1 33 ALA n 1 34 GLN n 1 35 CYS n 1 36 GLY n 1 37 GLU n 1 38 GLY n 1 39 LEU n 1 40 CYS n 1 41 CYS n 1 42 GLU n 1 43 GLN n 1 44 CYS n 1 45 LYS n 1 46 PHE n 1 47 SER n 1 48 ARG n 1 49 ALA n 1 50 GLY n 1 51 LYS n 1 52 ILE n 1 53 CYS n 1 54 ARG n 1 55 ILE n 1 56 ALA n 1 57 ARG n 1 58 GLY n 1 59 ASP n 1 60 TRP n 1 61 ASN n 1 62 ASP n 1 63 ASP n 1 64 ARG n 1 65 CYS n 1 66 THR n 1 67 GLY n 1 68 GLN n 1 69 SER n 1 70 ALA n 1 71 ASP n 1 72 CYS n 1 73 PRO n 1 74 ARG n 1 75 ASN n 1 76 GLY n 1 77 LEU n 1 78 TYR n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Malayan pit viper' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RHOD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Calloselasma rhodostoma' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8717 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pPICZ alpha A' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VM2RH_CALRH _struct_ref.pdbx_db_accession P30403 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYHSHA _struct_ref.pdbx_align_begin 408 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M7F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P30403 _struct_ref_seq.db_align_beg 408 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 478 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M7F GLU A 1 ? UNP P30403 ? ? 'EXPRESSION TAG' -7 1 1 2M7F PHE A 2 ? UNP P30403 ? ? 'EXPRESSION TAG' -6 2 1 2M7F HIS A 3 ? UNP P30403 ? ? 'EXPRESSION TAG' -5 3 1 2M7F HIS A 4 ? UNP P30403 ? ? 'EXPRESSION TAG' -4 4 1 2M7F HIS A 5 ? UNP P30403 ? ? 'EXPRESSION TAG' -3 5 1 2M7F HIS A 6 ? UNP P30403 ? ? 'EXPRESSION TAG' -2 6 1 2M7F HIS A 7 ? UNP P30403 ? ? 'EXPRESSION TAG' -1 7 1 2M7F HIS A 8 ? UNP P30403 ? ? 'EXPRESSION TAG' 0 8 1 2M7F ALA A 56 ? UNP P30403 PRO 455 'ENGINEERED MUTATION' 48 9 1 2M7F TRP A 60 ? UNP P30403 MET 459 'ENGINEERED MUTATION' 52 10 1 2M7F ASN A 61 ? UNP P30403 PRO 460 'ENGINEERED MUTATION' 53 11 1 2M7F ASN A 75 ? UNP P30403 TYR 474 'ENGINEERED MUTATION' 67 12 1 2M7F GLY A 76 ? UNP P30403 HIS 475 'ENGINEERED MUTATION' 68 13 1 2M7F LEU A 77 ? UNP P30403 SER 476 'ENGINEERED MUTATION' 69 14 1 2M7F TYR A 78 ? UNP P30403 HIS 477 'ENGINEERED MUTATION' 70 15 1 2M7F GLY A 79 ? UNP P30403 ALA 478 'ENGINEERED MUTATION' 71 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 2 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H TOCSY' 1 5 3 '3D 1H-15N NOESY' 1 6 3 '3D 1H-15N TOCSY' 1 7 3 '3D HNHA' 1 8 3 '2D 1H-15N HSQC' 1 9 4 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '2 mM 2mM Rhodostomin 48ARGDWN-67NGLYG mutant-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '2 mM 2mM Rhodostomin 48ARGDWN-67NGLYG mutant-2, 100% D2O' 2 '100% D2O' '2 mM [U-15N] 2mM Rhodostomin 48ARGDWN-67NGLYG mutant-3, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' '2 mM [U-15N] 2mM Rhodostomin 48ARGDWN-67NGLYG mutant-4, 100% D2O' 4 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M7F _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M7F _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 8 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M7F _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection xwinnmr 1 2.6 'Neidig, Geyer, Gorler, Antz, Saffrich, Beneicke, Kalbitzer' 'data analysis' AURELIA 2 3.1.7 Brunger refinement X-PLOR 3 3.185 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M7F _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M7F _struct.title 'The C-terminal Region of Disintegrin Modulate its 3D Conformation and Cooperate with RGD Loop in Regulating Integrins Recognitions' _struct.pdbx_descriptor 'Zinc metalloproteinase/disintegrin (E.C.3.4.24.-)' _struct.pdbx_model_details 'closest to the average, model8' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M7F _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Rhodostomin mutant protein, RGD motif, C-terminal region mutation, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 2.025 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 2.021 ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 13 A CYS 36 1_555 ? ? ? ? ? ? ? 2.018 ? disulf4 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 27 A CYS 33 1_555 ? ? ? ? ? ? ? 2.013 ? disulf5 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 32 A CYS 57 1_555 ? ? ? ? ? ? ? 2.017 ? disulf6 disulf ? ? A CYS 53 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 45 A CYS 64 1_555 ? ? ? ? ? ? ? 2.013 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 22 ? ASP A 23 ? CYS A 14 ASP A 15 A 2 LYS A 28 ? LEU A 29 ? LYS A 20 LEU A 21 B 1 CYS A 41 ? GLU A 42 ? CYS A 33 GLU A 34 B 2 LYS A 45 ? PHE A 46 ? LYS A 37 PHE A 38 C 1 ALA A 49 ? ARG A 54 ? ALA A 41 ARG A 46 C 2 ASP A 63 ? THR A 66 ? ASP A 55 THR A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 23 ? N ASP A 15 O LYS A 28 ? O LYS A 20 B 1 2 N GLU A 42 ? N GLU A 34 O LYS A 45 ? O LYS A 37 C 1 2 N GLY A 50 ? N GLY A 42 O CYS A 65 ? O CYS A 57 # _atom_sites.entry_id 2M7F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 -7 ? ? ? A . n A 1 2 PHE 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 GLY 9 1 1 GLY GLY A . n A 1 10 LYS 10 2 2 LYS LYS A . n A 1 11 GLU 11 3 3 GLU GLU A . n A 1 12 CYS 12 4 4 CYS CYS A . n A 1 13 ASP 13 5 5 ASP ASP A . n A 1 14 CYS 14 6 6 CYS CYS A . n A 1 15 SER 15 7 7 SER SER A . n A 1 16 SER 16 8 8 SER SER A . n A 1 17 PRO 17 9 9 PRO PRO A . n A 1 18 GLU 18 10 10 GLU GLU A . n A 1 19 ASN 19 11 11 ASN ASN A . n A 1 20 PRO 20 12 12 PRO PRO A . n A 1 21 CYS 21 13 13 CYS CYS A . n A 1 22 CYS 22 14 14 CYS CYS A . n A 1 23 ASP 23 15 15 ASP ASP A . n A 1 24 ALA 24 16 16 ALA ALA A . n A 1 25 ALA 25 17 17 ALA ALA A . n A 1 26 THR 26 18 18 THR THR A . n A 1 27 CYS 27 19 19 CYS CYS A . n A 1 28 LYS 28 20 20 LYS LYS A . n A 1 29 LEU 29 21 21 LEU LEU A . n A 1 30 ARG 30 22 22 ARG ARG A . n A 1 31 PRO 31 23 23 PRO PRO A . n A 1 32 GLY 32 24 24 GLY GLY A . n A 1 33 ALA 33 25 25 ALA ALA A . n A 1 34 GLN 34 26 26 GLN GLN A . n A 1 35 CYS 35 27 27 CYS CYS A . n A 1 36 GLY 36 28 28 GLY GLY A . n A 1 37 GLU 37 29 29 GLU GLU A . n A 1 38 GLY 38 30 30 GLY GLY A . n A 1 39 LEU 39 31 31 LEU LEU A . n A 1 40 CYS 40 32 32 CYS CYS A . n A 1 41 CYS 41 33 33 CYS CYS A . n A 1 42 GLU 42 34 34 GLU GLU A . n A 1 43 GLN 43 35 35 GLN GLN A . n A 1 44 CYS 44 36 36 CYS CYS A . n A 1 45 LYS 45 37 37 LYS LYS A . n A 1 46 PHE 46 38 38 PHE PHE A . n A 1 47 SER 47 39 39 SER SER A . n A 1 48 ARG 48 40 40 ARG ARG A . n A 1 49 ALA 49 41 41 ALA ALA A . n A 1 50 GLY 50 42 42 GLY GLY A . n A 1 51 LYS 51 43 43 LYS LYS A . n A 1 52 ILE 52 44 44 ILE ILE A . n A 1 53 CYS 53 45 45 CYS CYS A . n A 1 54 ARG 54 46 46 ARG ARG A . n A 1 55 ILE 55 47 47 ILE ILE A . n A 1 56 ALA 56 48 48 ALA ALA A . n A 1 57 ARG 57 49 49 ARG ARG A . n A 1 58 GLY 58 50 50 GLY GLY A . n A 1 59 ASP 59 51 51 ASP ASP A . n A 1 60 TRP 60 52 52 TRP TRP A . n A 1 61 ASN 61 53 53 ASN ASN A . n A 1 62 ASP 62 54 54 ASP ASP A . n A 1 63 ASP 63 55 55 ASP ASP A . n A 1 64 ARG 64 56 56 ARG ARG A . n A 1 65 CYS 65 57 57 CYS CYS A . n A 1 66 THR 66 58 58 THR THR A . n A 1 67 GLY 67 59 59 GLY GLY A . n A 1 68 GLN 68 60 60 GLN GLN A . n A 1 69 SER 69 61 61 SER SER A . n A 1 70 ALA 70 62 62 ALA ALA A . n A 1 71 ASP 71 63 63 ASP ASP A . n A 1 72 CYS 72 64 64 CYS CYS A . n A 1 73 PRO 73 65 65 PRO PRO A . n A 1 74 ARG 74 66 66 ARG ARG A . n A 1 75 ASN 75 67 67 ASN ASN A . n A 1 76 GLY 76 68 68 GLY GLY A . n A 1 77 LEU 77 69 69 LEU LEU A . n A 1 78 TYR 78 70 70 TYR TYR A . n A 1 79 GLY 79 71 71 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id '2mM Rhodostomin 48ARGDWN-67NGLYG mutant-1' 2 ? mM ? 1 '2mM Rhodostomin 48ARGDWN-67NGLYG mutant-2' 2 ? mM ? 2 '2mM Rhodostomin 48ARGDWN-67NGLYG mutant-3' 2 ? mM '[U-15N]' 3 '2mM Rhodostomin 48ARGDWN-67NGLYG mutant-4' 2 ? mM '[U-15N]' 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A LYS 43 ? ? H A CYS 57 ? ? 1.48 2 3 H A CYS 45 ? ? O A ASP 55 ? ? 1.54 3 4 H A ASP 15 ? ? O A LYS 20 ? ? 1.48 4 4 O A LYS 43 ? ? H A CYS 57 ? ? 1.59 5 5 O A LYS 43 ? ? H A CYS 57 ? ? 1.47 6 5 H A CYS 45 ? ? O A ASP 55 ? ? 1.47 7 5 H A ASP 5 ? ? O A CYS 19 ? ? 1.50 8 6 H A ASP 15 ? ? O A LYS 20 ? ? 1.47 9 7 H A ASP 15 ? ? O A LYS 20 ? ? 1.59 10 8 H A GLN 26 ? ? O A CYS 36 ? ? 1.44 11 9 H A ALA 48 ? ? OD2 A ASP 54 ? ? 1.52 12 9 H A ASP 15 ? ? O A LYS 20 ? ? 1.54 13 10 H A ASP 15 ? ? O A LYS 20 ? ? 1.48 14 10 O A LYS 43 ? ? H A CYS 57 ? ? 1.56 15 10 OD1 A ASP 54 ? ? HH12 A ARG 56 ? ? 1.57 16 11 H A ASP 15 ? ? O A LYS 20 ? ? 1.50 17 11 H A ASP 5 ? ? O A CYS 19 ? ? 1.51 18 11 OD1 A ASN 11 ? ? H A CYS 13 ? ? 1.54 19 11 H A CYS 32 ? ? O A ALA 62 ? ? 1.59 20 12 O A LYS 43 ? ? H A CYS 45 ? ? 1.50 21 12 H A ASP 5 ? ? O A CYS 19 ? ? 1.54 22 13 O A LYS 43 ? ? H A CYS 57 ? ? 1.50 23 13 H A GLY 42 ? ? O A CYS 57 ? ? 1.60 24 14 H A ASP 5 ? ? O A CYS 19 ? ? 1.49 25 15 O A LYS 43 ? ? H A CYS 57 ? ? 1.49 26 15 H A ASP 15 ? ? O A LYS 20 ? ? 1.49 27 16 O A LYS 43 ? ? H A CYS 57 ? ? 1.47 28 17 H A ASP 5 ? ? O A CYS 19 ? ? 1.48 29 18 O A LYS 43 ? ? H A CYS 57 ? ? 1.49 30 19 O A LYS 43 ? ? H A CYS 57 ? ? 1.49 31 20 H A ASP 15 ? ? O A LYS 20 ? ? 1.49 32 20 H A CYS 32 ? ? O A ALA 62 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -59.65 -168.46 2 1 CYS A 19 ? ? 34.00 35.09 3 1 PRO A 23 ? ? -77.28 -164.48 4 1 SER A 39 ? ? -60.42 -127.81 5 1 ASP A 51 ? ? -178.64 68.58 6 1 TRP A 52 ? ? -131.29 -84.18 7 2 LYS A 2 ? ? -112.04 -166.55 8 2 GLU A 3 ? ? -174.05 30.72 9 2 CYS A 19 ? ? 32.96 33.88 10 2 PRO A 23 ? ? -79.71 -162.96 11 2 SER A 39 ? ? -62.05 -131.75 12 2 ARG A 46 ? ? -159.72 -156.83 13 2 ASP A 51 ? ? -153.63 46.74 14 2 ASP A 54 ? ? -66.88 -136.90 15 2 PRO A 65 ? ? -79.61 -164.30 16 2 TYR A 70 ? ? -139.73 -47.19 17 3 LYS A 2 ? ? -113.96 52.42 18 3 GLU A 3 ? ? -141.82 24.85 19 3 PRO A 23 ? ? -78.42 -167.24 20 3 SER A 39 ? ? -59.83 -169.20 21 3 ARG A 46 ? ? -160.19 119.60 22 3 TRP A 52 ? ? -39.08 161.79 23 3 ASN A 53 ? ? -47.75 178.22 24 3 ASP A 54 ? ? -118.60 -138.89 25 3 LEU A 69 ? ? -92.31 48.43 26 4 GLU A 3 ? ? -146.95 10.46 27 4 CYS A 19 ? ? 33.20 36.25 28 4 PRO A 23 ? ? -78.44 -158.82 29 4 ASP A 51 ? ? -171.42 50.36 30 4 TYR A 70 ? ? -93.51 -74.14 31 5 CYS A 32 ? ? -152.96 27.29 32 5 CYS A 36 ? ? 75.33 -25.07 33 5 SER A 39 ? ? -65.66 -158.28 34 5 ASP A 51 ? ? -158.99 46.27 35 5 ASP A 54 ? ? -89.15 -143.37 36 5 PRO A 65 ? ? -77.92 -167.18 37 5 LEU A 69 ? ? -119.47 51.59 38 6 CYS A 19 ? ? 34.04 39.71 39 6 SER A 39 ? ? -61.66 -146.08 40 6 ILE A 44 ? ? -60.35 79.96 41 6 ASP A 51 ? ? -177.71 56.18 42 6 TRP A 52 ? ? -131.20 -110.37 43 6 ASP A 54 ? ? -81.98 -146.37 44 6 GLN A 60 ? ? -168.13 -33.91 45 7 CYS A 19 ? ? 35.99 36.90 46 7 PRO A 23 ? ? -78.12 -166.19 47 7 CYS A 32 ? ? -106.72 51.82 48 7 SER A 39 ? ? -61.72 -139.77 49 7 ARG A 49 ? ? -115.62 79.56 50 7 ASP A 51 ? ? 167.17 -48.40 51 7 TRP A 52 ? ? -43.01 164.27 52 7 ASP A 54 ? ? -62.03 -155.67 53 7 PRO A 65 ? ? -79.40 -165.54 54 8 ALA A 25 ? ? -114.30 -146.40 55 8 GLN A 26 ? ? -142.12 -45.58 56 8 CYS A 36 ? ? 78.97 -2.96 57 8 ILE A 44 ? ? -59.66 86.19 58 8 ASP A 51 ? ? -178.03 54.52 59 8 TRP A 52 ? ? -128.88 -106.79 60 8 ASP A 54 ? ? -73.32 -151.07 61 8 PRO A 65 ? ? -78.81 -168.43 62 8 TYR A 70 ? ? -156.69 38.41 63 9 GLU A 3 ? ? -99.88 43.43 64 9 CYS A 19 ? ? 34.41 31.83 65 9 PRO A 23 ? ? -77.72 -169.98 66 9 CYS A 32 ? ? -98.90 44.18 67 9 SER A 39 ? ? -59.82 177.11 68 9 ASP A 51 ? ? -156.04 44.24 69 9 TRP A 52 ? ? -126.81 -168.37 70 10 LYS A 2 ? ? -92.92 46.74 71 10 CYS A 19 ? ? 34.96 40.42 72 10 SER A 39 ? ? -61.25 -123.15 73 10 ILE A 44 ? ? -59.32 94.60 74 10 ASP A 51 ? ? -174.58 57.33 75 10 TRP A 52 ? ? -126.62 -103.51 76 11 GLU A 3 ? ? -173.48 28.37 77 11 CYS A 4 ? ? -179.64 132.26 78 11 PRO A 23 ? ? -75.95 -164.19 79 11 SER A 39 ? ? -62.36 -140.82 80 11 ILE A 44 ? ? -58.34 99.88 81 11 ALA A 48 ? ? -57.32 -161.84 82 11 ASP A 51 ? ? 84.46 -24.73 83 11 ASP A 54 ? ? -81.51 -139.72 84 11 PRO A 65 ? ? -78.37 -168.73 85 12 LYS A 2 ? ? -101.04 -102.36 86 12 CYS A 6 ? ? -124.82 -165.20 87 12 PRO A 23 ? ? -76.68 -159.59 88 12 CYS A 36 ? ? 79.42 -3.47 89 12 SER A 39 ? ? -60.63 -155.92 90 12 ILE A 44 ? ? -63.96 63.19 91 12 ASP A 51 ? ? -172.94 51.17 92 12 LEU A 69 ? ? -92.39 39.00 93 13 PRO A 23 ? ? -79.38 -167.32 94 13 CYS A 27 ? ? -170.45 135.25 95 13 CYS A 32 ? ? -93.78 51.82 96 13 SER A 39 ? ? -60.04 -171.50 97 13 ASP A 51 ? ? 81.43 70.65 98 13 TRP A 52 ? ? -130.33 -113.05 99 13 ASN A 67 ? ? -115.90 53.87 100 14 GLU A 3 ? ? -117.07 73.49 101 14 CYS A 19 ? ? 55.38 16.99 102 14 SER A 39 ? ? -59.71 -179.82 103 14 ARG A 46 ? ? -161.22 -166.16 104 14 ALA A 48 ? ? -48.03 154.95 105 14 ASP A 51 ? ? -175.30 58.51 106 14 TRP A 52 ? ? -130.43 -106.54 107 15 GLU A 10 ? ? -150.03 19.56 108 15 PRO A 12 ? ? -78.82 42.58 109 15 CYS A 13 ? ? -131.27 -45.55 110 15 CYS A 19 ? ? 33.10 38.79 111 15 PRO A 23 ? ? -79.11 -165.21 112 15 CYS A 36 ? ? 75.69 39.58 113 15 SER A 39 ? ? -66.52 -144.42 114 15 ASP A 51 ? ? -162.31 49.16 115 15 TRP A 52 ? ? -113.29 -166.43 116 16 GLU A 3 ? ? -176.15 55.07 117 16 CYS A 19 ? ? 32.34 33.84 118 16 SER A 39 ? ? -62.96 -132.20 119 16 ALA A 48 ? ? -58.45 -170.69 120 16 ARG A 49 ? ? -167.72 73.55 121 16 ASP A 51 ? ? -155.38 41.25 122 16 PRO A 65 ? ? -77.74 -159.26 123 17 ASP A 15 ? ? -58.00 108.46 124 17 LYS A 20 ? ? -117.29 -167.92 125 17 PRO A 23 ? ? -79.06 -160.43 126 17 GLN A 35 ? ? 72.06 36.01 127 17 SER A 39 ? ? -59.90 174.90 128 17 ILE A 44 ? ? -63.70 89.26 129 17 ASP A 51 ? ? -158.01 43.82 130 17 ASP A 54 ? ? -75.08 -142.93 131 18 GLU A 3 ? ? -116.98 -89.93 132 18 ARG A 22 ? ? -105.52 -68.11 133 18 CYS A 32 ? ? -92.40 38.72 134 18 SER A 39 ? ? -63.83 -128.78 135 18 ILE A 44 ? ? -62.11 75.57 136 18 ASP A 51 ? ? -142.16 50.48 137 18 TRP A 52 ? ? -128.51 -165.57 138 18 ASP A 54 ? ? -98.86 -142.83 139 19 PRO A 23 ? ? -79.10 -166.74 140 19 CYS A 32 ? ? -107.18 41.48 141 19 SER A 39 ? ? -59.83 -170.48 142 19 ALA A 48 ? ? -61.69 -178.95 143 19 ARG A 49 ? ? -161.02 80.10 144 19 ASP A 51 ? ? 165.25 -50.54 145 19 ASN A 53 ? ? -50.93 -176.98 146 19 PRO A 65 ? ? -78.85 -167.32 147 20 LYS A 2 ? ? -147.90 58.37 148 20 CYS A 19 ? ? 35.51 35.67 149 20 PRO A 23 ? ? -79.44 -160.81 150 20 CYS A 27 ? ? -171.01 147.63 151 20 SER A 39 ? ? -60.45 -176.44 152 20 ILE A 44 ? ? -58.94 105.16 153 20 ASP A 51 ? ? 177.22 70.23 154 20 TRP A 52 ? ? -117.94 -77.61 155 20 PRO A 65 ? ? -78.90 -166.41 156 20 LEU A 69 ? ? -123.26 -162.88 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 22 ? ? 0.218 'SIDE CHAIN' 2 1 ARG A 40 ? ? 0.208 'SIDE CHAIN' 3 1 ARG A 46 ? ? 0.197 'SIDE CHAIN' 4 1 ARG A 49 ? ? 0.315 'SIDE CHAIN' 5 1 ARG A 56 ? ? 0.318 'SIDE CHAIN' 6 1 ARG A 66 ? ? 0.300 'SIDE CHAIN' 7 2 ARG A 22 ? ? 0.313 'SIDE CHAIN' 8 2 ARG A 40 ? ? 0.291 'SIDE CHAIN' 9 2 ARG A 46 ? ? 0.313 'SIDE CHAIN' 10 2 ARG A 49 ? ? 0.208 'SIDE CHAIN' 11 2 ARG A 56 ? ? 0.112 'SIDE CHAIN' 12 2 ARG A 66 ? ? 0.291 'SIDE CHAIN' 13 3 ARG A 22 ? ? 0.302 'SIDE CHAIN' 14 3 ARG A 40 ? ? 0.227 'SIDE CHAIN' 15 3 ARG A 46 ? ? 0.155 'SIDE CHAIN' 16 3 ARG A 56 ? ? 0.295 'SIDE CHAIN' 17 3 ARG A 66 ? ? 0.264 'SIDE CHAIN' 18 4 ARG A 22 ? ? 0.260 'SIDE CHAIN' 19 4 ARG A 40 ? ? 0.225 'SIDE CHAIN' 20 4 ARG A 46 ? ? 0.306 'SIDE CHAIN' 21 4 ARG A 49 ? ? 0.272 'SIDE CHAIN' 22 4 ARG A 56 ? ? 0.182 'SIDE CHAIN' 23 4 ARG A 66 ? ? 0.094 'SIDE CHAIN' 24 5 ARG A 22 ? ? 0.149 'SIDE CHAIN' 25 5 ARG A 40 ? ? 0.306 'SIDE CHAIN' 26 5 ARG A 46 ? ? 0.176 'SIDE CHAIN' 27 5 ARG A 49 ? ? 0.307 'SIDE CHAIN' 28 5 ARG A 56 ? ? 0.281 'SIDE CHAIN' 29 5 ARG A 66 ? ? 0.283 'SIDE CHAIN' 30 6 ARG A 22 ? ? 0.271 'SIDE CHAIN' 31 6 ARG A 40 ? ? 0.235 'SIDE CHAIN' 32 6 ARG A 46 ? ? 0.313 'SIDE CHAIN' 33 6 ARG A 49 ? ? 0.272 'SIDE CHAIN' 34 6 ARG A 66 ? ? 0.284 'SIDE CHAIN' 35 7 ARG A 22 ? ? 0.234 'SIDE CHAIN' 36 7 ARG A 40 ? ? 0.290 'SIDE CHAIN' 37 7 ARG A 46 ? ? 0.287 'SIDE CHAIN' 38 7 ARG A 49 ? ? 0.219 'SIDE CHAIN' 39 7 ARG A 56 ? ? 0.316 'SIDE CHAIN' 40 7 ARG A 66 ? ? 0.157 'SIDE CHAIN' 41 8 ARG A 22 ? ? 0.259 'SIDE CHAIN' 42 8 ARG A 46 ? ? 0.196 'SIDE CHAIN' 43 8 ARG A 49 ? ? 0.316 'SIDE CHAIN' 44 8 ARG A 56 ? ? 0.203 'SIDE CHAIN' 45 8 ARG A 66 ? ? 0.203 'SIDE CHAIN' 46 9 ARG A 22 ? ? 0.192 'SIDE CHAIN' 47 9 ARG A 40 ? ? 0.285 'SIDE CHAIN' 48 9 ARG A 46 ? ? 0.300 'SIDE CHAIN' 49 9 ARG A 49 ? ? 0.183 'SIDE CHAIN' 50 9 ARG A 56 ? ? 0.234 'SIDE CHAIN' 51 9 ARG A 66 ? ? 0.078 'SIDE CHAIN' 52 10 ARG A 22 ? ? 0.284 'SIDE CHAIN' 53 10 ARG A 40 ? ? 0.287 'SIDE CHAIN' 54 10 ARG A 46 ? ? 0.302 'SIDE CHAIN' 55 10 ARG A 49 ? ? 0.148 'SIDE CHAIN' 56 10 ARG A 56 ? ? 0.169 'SIDE CHAIN' 57 10 ARG A 66 ? ? 0.229 'SIDE CHAIN' 58 11 ARG A 22 ? ? 0.289 'SIDE CHAIN' 59 11 ARG A 40 ? ? 0.246 'SIDE CHAIN' 60 11 ARG A 49 ? ? 0.312 'SIDE CHAIN' 61 11 ARG A 56 ? ? 0.218 'SIDE CHAIN' 62 11 ARG A 66 ? ? 0.279 'SIDE CHAIN' 63 12 ARG A 22 ? ? 0.146 'SIDE CHAIN' 64 12 ARG A 40 ? ? 0.241 'SIDE CHAIN' 65 12 ARG A 46 ? ? 0.263 'SIDE CHAIN' 66 12 ARG A 49 ? ? 0.284 'SIDE CHAIN' 67 12 ARG A 56 ? ? 0.296 'SIDE CHAIN' 68 12 ARG A 66 ? ? 0.089 'SIDE CHAIN' 69 13 ARG A 22 ? ? 0.126 'SIDE CHAIN' 70 13 ARG A 40 ? ? 0.204 'SIDE CHAIN' 71 13 ARG A 46 ? ? 0.160 'SIDE CHAIN' 72 13 ARG A 49 ? ? 0.236 'SIDE CHAIN' 73 13 ARG A 56 ? ? 0.208 'SIDE CHAIN' 74 13 ARG A 66 ? ? 0.317 'SIDE CHAIN' 75 14 ARG A 22 ? ? 0.298 'SIDE CHAIN' 76 14 ARG A 40 ? ? 0.309 'SIDE CHAIN' 77 14 ARG A 46 ? ? 0.306 'SIDE CHAIN' 78 14 ARG A 49 ? ? 0.317 'SIDE CHAIN' 79 14 ARG A 66 ? ? 0.313 'SIDE CHAIN' 80 15 ARG A 22 ? ? 0.205 'SIDE CHAIN' 81 15 ARG A 40 ? ? 0.310 'SIDE CHAIN' 82 15 ARG A 46 ? ? 0.317 'SIDE CHAIN' 83 15 ARG A 49 ? ? 0.310 'SIDE CHAIN' 84 15 ARG A 56 ? ? 0.196 'SIDE CHAIN' 85 15 ARG A 66 ? ? 0.096 'SIDE CHAIN' 86 16 ARG A 22 ? ? 0.189 'SIDE CHAIN' 87 16 ARG A 40 ? ? 0.317 'SIDE CHAIN' 88 16 ARG A 46 ? ? 0.317 'SIDE CHAIN' 89 16 ARG A 49 ? ? 0.309 'SIDE CHAIN' 90 16 ARG A 56 ? ? 0.223 'SIDE CHAIN' 91 16 ARG A 66 ? ? 0.293 'SIDE CHAIN' 92 17 ARG A 40 ? ? 0.280 'SIDE CHAIN' 93 17 ARG A 46 ? ? 0.169 'SIDE CHAIN' 94 17 ARG A 49 ? ? 0.318 'SIDE CHAIN' 95 17 ARG A 56 ? ? 0.273 'SIDE CHAIN' 96 17 ARG A 66 ? ? 0.177 'SIDE CHAIN' 97 18 ARG A 22 ? ? 0.111 'SIDE CHAIN' 98 18 ARG A 40 ? ? 0.312 'SIDE CHAIN' 99 18 ARG A 46 ? ? 0.250 'SIDE CHAIN' 100 18 ARG A 49 ? ? 0.170 'SIDE CHAIN' 101 18 ARG A 56 ? ? 0.298 'SIDE CHAIN' 102 18 ARG A 66 ? ? 0.233 'SIDE CHAIN' 103 19 ARG A 22 ? ? 0.317 'SIDE CHAIN' 104 19 ARG A 40 ? ? 0.305 'SIDE CHAIN' 105 19 ARG A 46 ? ? 0.317 'SIDE CHAIN' 106 19 ARG A 49 ? ? 0.295 'SIDE CHAIN' 107 19 ARG A 66 ? ? 0.232 'SIDE CHAIN' 108 20 ARG A 22 ? ? 0.172 'SIDE CHAIN' 109 20 ARG A 40 ? ? 0.101 'SIDE CHAIN' 110 20 ARG A 46 ? ? 0.309 'SIDE CHAIN' 111 20 ARG A 49 ? ? 0.317 'SIDE CHAIN' 112 20 ARG A 56 ? ? 0.210 'SIDE CHAIN' 113 20 ARG A 66 ? ? 0.238 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU -7 ? A GLU 1 2 1 Y 1 A PHE -6 ? A PHE 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 2 Y 1 A GLU -7 ? A GLU 1 10 2 Y 1 A PHE -6 ? A PHE 2 11 2 Y 1 A HIS -5 ? A HIS 3 12 2 Y 1 A HIS -4 ? A HIS 4 13 2 Y 1 A HIS -3 ? A HIS 5 14 2 Y 1 A HIS -2 ? A HIS 6 15 2 Y 1 A HIS -1 ? A HIS 7 16 2 Y 1 A HIS 0 ? A HIS 8 17 3 Y 1 A GLU -7 ? A GLU 1 18 3 Y 1 A PHE -6 ? A PHE 2 19 3 Y 1 A HIS -5 ? A HIS 3 20 3 Y 1 A HIS -4 ? A HIS 4 21 3 Y 1 A HIS -3 ? A HIS 5 22 3 Y 1 A HIS -2 ? A HIS 6 23 3 Y 1 A HIS -1 ? A HIS 7 24 3 Y 1 A HIS 0 ? A HIS 8 25 4 Y 1 A GLU -7 ? A GLU 1 26 4 Y 1 A PHE -6 ? A PHE 2 27 4 Y 1 A HIS -5 ? A HIS 3 28 4 Y 1 A HIS -4 ? A HIS 4 29 4 Y 1 A HIS -3 ? A HIS 5 30 4 Y 1 A HIS -2 ? A HIS 6 31 4 Y 1 A HIS -1 ? A HIS 7 32 4 Y 1 A HIS 0 ? A HIS 8 33 5 Y 1 A GLU -7 ? A GLU 1 34 5 Y 1 A PHE -6 ? A PHE 2 35 5 Y 1 A HIS -5 ? A HIS 3 36 5 Y 1 A HIS -4 ? A HIS 4 37 5 Y 1 A HIS -3 ? A HIS 5 38 5 Y 1 A HIS -2 ? A HIS 6 39 5 Y 1 A HIS -1 ? A HIS 7 40 5 Y 1 A HIS 0 ? A HIS 8 41 6 Y 1 A GLU -7 ? A GLU 1 42 6 Y 1 A PHE -6 ? A PHE 2 43 6 Y 1 A HIS -5 ? A HIS 3 44 6 Y 1 A HIS -4 ? A HIS 4 45 6 Y 1 A HIS -3 ? A HIS 5 46 6 Y 1 A HIS -2 ? A HIS 6 47 6 Y 1 A HIS -1 ? A HIS 7 48 6 Y 1 A HIS 0 ? A HIS 8 49 7 Y 1 A GLU -7 ? A GLU 1 50 7 Y 1 A PHE -6 ? A PHE 2 51 7 Y 1 A HIS -5 ? A HIS 3 52 7 Y 1 A HIS -4 ? A HIS 4 53 7 Y 1 A HIS -3 ? A HIS 5 54 7 Y 1 A HIS -2 ? A HIS 6 55 7 Y 1 A HIS -1 ? A HIS 7 56 7 Y 1 A HIS 0 ? A HIS 8 57 8 Y 1 A GLU -7 ? A GLU 1 58 8 Y 1 A PHE -6 ? A PHE 2 59 8 Y 1 A HIS -5 ? A HIS 3 60 8 Y 1 A HIS -4 ? A HIS 4 61 8 Y 1 A HIS -3 ? A HIS 5 62 8 Y 1 A HIS -2 ? A HIS 6 63 8 Y 1 A HIS -1 ? A HIS 7 64 8 Y 1 A HIS 0 ? A HIS 8 65 9 Y 1 A GLU -7 ? A GLU 1 66 9 Y 1 A PHE -6 ? A PHE 2 67 9 Y 1 A HIS -5 ? A HIS 3 68 9 Y 1 A HIS -4 ? A HIS 4 69 9 Y 1 A HIS -3 ? A HIS 5 70 9 Y 1 A HIS -2 ? A HIS 6 71 9 Y 1 A HIS -1 ? A HIS 7 72 9 Y 1 A HIS 0 ? A HIS 8 73 10 Y 1 A GLU -7 ? A GLU 1 74 10 Y 1 A PHE -6 ? A PHE 2 75 10 Y 1 A HIS -5 ? A HIS 3 76 10 Y 1 A HIS -4 ? A HIS 4 77 10 Y 1 A HIS -3 ? A HIS 5 78 10 Y 1 A HIS -2 ? A HIS 6 79 10 Y 1 A HIS -1 ? A HIS 7 80 10 Y 1 A HIS 0 ? A HIS 8 81 11 Y 1 A GLU -7 ? A GLU 1 82 11 Y 1 A PHE -6 ? A PHE 2 83 11 Y 1 A HIS -5 ? A HIS 3 84 11 Y 1 A HIS -4 ? A HIS 4 85 11 Y 1 A HIS -3 ? A HIS 5 86 11 Y 1 A HIS -2 ? A HIS 6 87 11 Y 1 A HIS -1 ? A HIS 7 88 11 Y 1 A HIS 0 ? A HIS 8 89 12 Y 1 A GLU -7 ? A GLU 1 90 12 Y 1 A PHE -6 ? A PHE 2 91 12 Y 1 A HIS -5 ? A HIS 3 92 12 Y 1 A HIS -4 ? A HIS 4 93 12 Y 1 A HIS -3 ? A HIS 5 94 12 Y 1 A HIS -2 ? A HIS 6 95 12 Y 1 A HIS -1 ? A HIS 7 96 12 Y 1 A HIS 0 ? A HIS 8 97 13 Y 1 A GLU -7 ? A GLU 1 98 13 Y 1 A PHE -6 ? A PHE 2 99 13 Y 1 A HIS -5 ? A HIS 3 100 13 Y 1 A HIS -4 ? A HIS 4 101 13 Y 1 A HIS -3 ? A HIS 5 102 13 Y 1 A HIS -2 ? A HIS 6 103 13 Y 1 A HIS -1 ? A HIS 7 104 13 Y 1 A HIS 0 ? A HIS 8 105 14 Y 1 A GLU -7 ? A GLU 1 106 14 Y 1 A PHE -6 ? A PHE 2 107 14 Y 1 A HIS -5 ? A HIS 3 108 14 Y 1 A HIS -4 ? A HIS 4 109 14 Y 1 A HIS -3 ? A HIS 5 110 14 Y 1 A HIS -2 ? A HIS 6 111 14 Y 1 A HIS -1 ? A HIS 7 112 14 Y 1 A HIS 0 ? A HIS 8 113 15 Y 1 A GLU -7 ? A GLU 1 114 15 Y 1 A PHE -6 ? A PHE 2 115 15 Y 1 A HIS -5 ? A HIS 3 116 15 Y 1 A HIS -4 ? A HIS 4 117 15 Y 1 A HIS -3 ? A HIS 5 118 15 Y 1 A HIS -2 ? A HIS 6 119 15 Y 1 A HIS -1 ? A HIS 7 120 15 Y 1 A HIS 0 ? A HIS 8 121 16 Y 1 A GLU -7 ? A GLU 1 122 16 Y 1 A PHE -6 ? A PHE 2 123 16 Y 1 A HIS -5 ? A HIS 3 124 16 Y 1 A HIS -4 ? A HIS 4 125 16 Y 1 A HIS -3 ? A HIS 5 126 16 Y 1 A HIS -2 ? A HIS 6 127 16 Y 1 A HIS -1 ? A HIS 7 128 16 Y 1 A HIS 0 ? A HIS 8 129 17 Y 1 A GLU -7 ? A GLU 1 130 17 Y 1 A PHE -6 ? A PHE 2 131 17 Y 1 A HIS -5 ? A HIS 3 132 17 Y 1 A HIS -4 ? A HIS 4 133 17 Y 1 A HIS -3 ? A HIS 5 134 17 Y 1 A HIS -2 ? A HIS 6 135 17 Y 1 A HIS -1 ? A HIS 7 136 17 Y 1 A HIS 0 ? A HIS 8 137 18 Y 1 A GLU -7 ? A GLU 1 138 18 Y 1 A PHE -6 ? A PHE 2 139 18 Y 1 A HIS -5 ? A HIS 3 140 18 Y 1 A HIS -4 ? A HIS 4 141 18 Y 1 A HIS -3 ? A HIS 5 142 18 Y 1 A HIS -2 ? A HIS 6 143 18 Y 1 A HIS -1 ? A HIS 7 144 18 Y 1 A HIS 0 ? A HIS 8 145 19 Y 1 A GLU -7 ? A GLU 1 146 19 Y 1 A PHE -6 ? A PHE 2 147 19 Y 1 A HIS -5 ? A HIS 3 148 19 Y 1 A HIS -4 ? A HIS 4 149 19 Y 1 A HIS -3 ? A HIS 5 150 19 Y 1 A HIS -2 ? A HIS 6 151 19 Y 1 A HIS -1 ? A HIS 7 152 19 Y 1 A HIS 0 ? A HIS 8 153 20 Y 1 A GLU -7 ? A GLU 1 154 20 Y 1 A PHE -6 ? A PHE 2 155 20 Y 1 A HIS -5 ? A HIS 3 156 20 Y 1 A HIS -4 ? A HIS 4 157 20 Y 1 A HIS -3 ? A HIS 5 158 20 Y 1 A HIS -2 ? A HIS 6 159 20 Y 1 A HIS -1 ? A HIS 7 160 20 Y 1 A HIS 0 ? A HIS 8 #