data_2M7H # _entry.id 2M7H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M7H RCSB RCSB103305 BMRB 19212 WWPDB D_1000103305 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 19212 BMRB . unspecified 2PJI PDB . unspecified 2m7f PDB . unspecified 2m75 PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M7H _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-04-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chuang, W.' 1 'Chang, Y.' 2 # _citation.id primary _citation.title ;The C-terminal Region of Disintegrin Modulate its 3D Conformation and Cooperate with RGD Loop in Regulating Recognitions of Integrins ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chuang, W.' 1 primary 'Chang, Y.' 2 primary 'Shiu, J.' 3 primary 'Chen, C.' 4 primary 'Chen, Y.' 5 # _cell.entry_id 2M7H _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M7H _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Zinc metalloproteinase/disintegrin' _entity.formula_weight 8759.756 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.24.- _entity.pdbx_mutation P48A,M52W,P53N,Y67N,H68P,S69W,H70N,A71G _entity.pdbx_fragment 'UNP residues 408-478' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Snake venom metalloproteinase rhodostoxin, SVMP, Hemorrhagic protein, Disintegrin rhodostomin, RHO, Disintegrin kistrin, Platelet aggregation activation inhibitor ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EFHHHHHHGKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQSADCPRNPWNG _entity_poly.pdbx_seq_one_letter_code_can EFHHHHHHGKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQSADCPRNPWNG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 GLY n 1 10 LYS n 1 11 GLU n 1 12 CYS n 1 13 ASP n 1 14 CYS n 1 15 SER n 1 16 SER n 1 17 PRO n 1 18 GLU n 1 19 ASN n 1 20 PRO n 1 21 CYS n 1 22 CYS n 1 23 ASP n 1 24 ALA n 1 25 ALA n 1 26 THR n 1 27 CYS n 1 28 LYS n 1 29 LEU n 1 30 ARG n 1 31 PRO n 1 32 GLY n 1 33 ALA n 1 34 GLN n 1 35 CYS n 1 36 GLY n 1 37 GLU n 1 38 GLY n 1 39 LEU n 1 40 CYS n 1 41 CYS n 1 42 GLU n 1 43 GLN n 1 44 CYS n 1 45 LYS n 1 46 PHE n 1 47 SER n 1 48 ARG n 1 49 ALA n 1 50 GLY n 1 51 LYS n 1 52 ILE n 1 53 CYS n 1 54 ARG n 1 55 ILE n 1 56 ALA n 1 57 ARG n 1 58 GLY n 1 59 ASP n 1 60 TRP n 1 61 ASN n 1 62 ASP n 1 63 ASP n 1 64 ARG n 1 65 CYS n 1 66 THR n 1 67 GLY n 1 68 GLN n 1 69 SER n 1 70 ALA n 1 71 ASP n 1 72 CYS n 1 73 PRO n 1 74 ARG n 1 75 ASN n 1 76 PRO n 1 77 TRP n 1 78 ASN n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Malayan pit viper' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RHOD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Calloselasma rhodostoma' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8717 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pPICZ alpha A' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VM2RH_CALRH _struct_ref.pdbx_db_accession P30403 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYHSHA _struct_ref.pdbx_align_begin 408 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M7H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P30403 _struct_ref_seq.db_align_beg 408 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 478 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M7H GLU A 1 ? UNP P30403 ? ? 'EXPRESSION TAG' -7 1 1 2M7H PHE A 2 ? UNP P30403 ? ? 'EXPRESSION TAG' -6 2 1 2M7H HIS A 3 ? UNP P30403 ? ? 'EXPRESSION TAG' -5 3 1 2M7H HIS A 4 ? UNP P30403 ? ? 'EXPRESSION TAG' -4 4 1 2M7H HIS A 5 ? UNP P30403 ? ? 'EXPRESSION TAG' -3 5 1 2M7H HIS A 6 ? UNP P30403 ? ? 'EXPRESSION TAG' -2 6 1 2M7H HIS A 7 ? UNP P30403 ? ? 'EXPRESSION TAG' -1 7 1 2M7H HIS A 8 ? UNP P30403 ? ? 'EXPRESSION TAG' 0 8 1 2M7H ALA A 56 ? UNP P30403 PRO 455 'ENGINEERED MUTATION' 48 9 1 2M7H TRP A 60 ? UNP P30403 MET 459 'ENGINEERED MUTATION' 52 10 1 2M7H ASN A 61 ? UNP P30403 PRO 460 'ENGINEERED MUTATION' 53 11 1 2M7H ASN A 75 ? UNP P30403 TYR 474 'ENGINEERED MUTATION' 67 12 1 2M7H PRO A 76 ? UNP P30403 HIS 475 'ENGINEERED MUTATION' 68 13 1 2M7H TRP A 77 ? UNP P30403 SER 476 'ENGINEERED MUTATION' 69 14 1 2M7H ASN A 78 ? UNP P30403 HIS 477 'ENGINEERED MUTATION' 70 15 1 2M7H GLY A 79 ? UNP P30403 ALA 478 'ENGINEERED MUTATION' 71 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 2 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H TOCSY' 1 5 3 '3D 1H-15N NOESY' 1 6 3 '3D 1H-15N TOCSY' 1 7 3 '3D HNHA' 1 8 3 '2D 1H-15N HSQC' 1 9 4 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.0 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '2 mM 2mM Rhodostomin 48ARGDWN-67NPWNG mutant-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '2 mM 2mM Rhodostomin 48ARGDWN-67NPWNG mutant-2, 100% D2O' 2 '100% D2O' '2 mM [U-15N] 2mM Rhodostomin 48ARGDWN-67NPWNG mutant-3, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' '2 mM [U-15N] 2mM Rhodostomin 48ARGDWN-67NPWNG mutant-4, 100% D2O' 4 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M7H _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M7H _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 8 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M7H _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection xwinnmr 1 2.6 'Neidig, Geyer, Gorler, Antz, Saffrich, Beneicke, Kalbitzer' 'data analysis' AURELIA 2 3.1.7 Brunger refinement X-PLOR 3 3.185 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M7H _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M7H _struct.title ;The C-terminal Region of Disintegrin Modulate its 3D Conformation and Cooperate with RGD Loop in Regulating Integrin alpha-IIb beta-3 Recognition ; _struct.pdbx_descriptor 'Zinc metalloproteinase/disintegrin (E.C.3.4.24.-)' _struct.pdbx_model_details 'closest to the average, model8' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M7H _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Rhodostomin muant, RGD motif, C-terminal region mutations, integrin alpha-IIb beta-3, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 2.023 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 2.020 ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 13 A CYS 36 1_555 ? ? ? ? ? ? ? 2.017 ? disulf4 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 27 A CYS 33 1_555 ? ? ? ? ? ? ? 2.023 ? disulf5 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 32 A CYS 57 1_555 ? ? ? ? ? ? ? 2.018 ? disulf6 disulf ? ? A CYS 53 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 45 A CYS 64 1_555 ? ? ? ? ? ? ? 2.018 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 22 ? ASP A 23 ? CYS A 14 ASP A 15 A 2 LYS A 28 ? LEU A 29 ? LYS A 20 LEU A 21 B 1 CYS A 41 ? GLU A 42 ? CYS A 33 GLU A 34 B 2 LYS A 45 ? PHE A 46 ? LYS A 37 PHE A 38 C 1 LYS A 51 ? ARG A 54 ? LYS A 43 ARG A 46 C 2 ASP A 63 ? CYS A 65 ? ASP A 55 CYS A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 23 ? N ASP A 15 O LYS A 28 ? O LYS A 20 B 1 2 N GLU A 42 ? N GLU A 34 O LYS A 45 ? O LYS A 37 C 1 2 N LYS A 51 ? N LYS A 43 O CYS A 65 ? O CYS A 57 # _atom_sites.entry_id 2M7H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 -7 ? ? ? A . n A 1 2 PHE 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 GLY 9 1 1 GLY GLY A . n A 1 10 LYS 10 2 2 LYS LYS A . n A 1 11 GLU 11 3 3 GLU GLU A . n A 1 12 CYS 12 4 4 CYS CYS A . n A 1 13 ASP 13 5 5 ASP ASP A . n A 1 14 CYS 14 6 6 CYS CYS A . n A 1 15 SER 15 7 7 SER SER A . n A 1 16 SER 16 8 8 SER SER A . n A 1 17 PRO 17 9 9 PRO PRO A . n A 1 18 GLU 18 10 10 GLU GLU A . n A 1 19 ASN 19 11 11 ASN ASN A . n A 1 20 PRO 20 12 12 PRO PRO A . n A 1 21 CYS 21 13 13 CYS CYS A . n A 1 22 CYS 22 14 14 CYS CYS A . n A 1 23 ASP 23 15 15 ASP ASP A . n A 1 24 ALA 24 16 16 ALA ALA A . n A 1 25 ALA 25 17 17 ALA ALA A . n A 1 26 THR 26 18 18 THR THR A . n A 1 27 CYS 27 19 19 CYS CYS A . n A 1 28 LYS 28 20 20 LYS LYS A . n A 1 29 LEU 29 21 21 LEU LEU A . n A 1 30 ARG 30 22 22 ARG ARG A . n A 1 31 PRO 31 23 23 PRO PRO A . n A 1 32 GLY 32 24 24 GLY GLY A . n A 1 33 ALA 33 25 25 ALA ALA A . n A 1 34 GLN 34 26 26 GLN GLN A . n A 1 35 CYS 35 27 27 CYS CYS A . n A 1 36 GLY 36 28 28 GLY GLY A . n A 1 37 GLU 37 29 29 GLU GLU A . n A 1 38 GLY 38 30 30 GLY GLY A . n A 1 39 LEU 39 31 31 LEU LEU A . n A 1 40 CYS 40 32 32 CYS CYS A . n A 1 41 CYS 41 33 33 CYS CYS A . n A 1 42 GLU 42 34 34 GLU GLU A . n A 1 43 GLN 43 35 35 GLN GLN A . n A 1 44 CYS 44 36 36 CYS CYS A . n A 1 45 LYS 45 37 37 LYS LYS A . n A 1 46 PHE 46 38 38 PHE PHE A . n A 1 47 SER 47 39 39 SER SER A . n A 1 48 ARG 48 40 40 ARG ARG A . n A 1 49 ALA 49 41 41 ALA ALA A . n A 1 50 GLY 50 42 42 GLY GLY A . n A 1 51 LYS 51 43 43 LYS LYS A . n A 1 52 ILE 52 44 44 ILE ILE A . n A 1 53 CYS 53 45 45 CYS CYS A . n A 1 54 ARG 54 46 46 ARG ARG A . n A 1 55 ILE 55 47 47 ILE ILE A . n A 1 56 ALA 56 48 48 ALA ALA A . n A 1 57 ARG 57 49 49 ARG ARG A . n A 1 58 GLY 58 50 50 GLY GLY A . n A 1 59 ASP 59 51 51 ASP ASP A . n A 1 60 TRP 60 52 52 TRP TRP A . n A 1 61 ASN 61 53 53 ASN ASN A . n A 1 62 ASP 62 54 54 ASP ASP A . n A 1 63 ASP 63 55 55 ASP ASP A . n A 1 64 ARG 64 56 56 ARG ARG A . n A 1 65 CYS 65 57 57 CYS CYS A . n A 1 66 THR 66 58 58 THR THR A . n A 1 67 GLY 67 59 59 GLY GLY A . n A 1 68 GLN 68 60 60 GLN GLN A . n A 1 69 SER 69 61 61 SER SER A . n A 1 70 ALA 70 62 62 ALA ALA A . n A 1 71 ASP 71 63 63 ASP ASP A . n A 1 72 CYS 72 64 64 CYS CYS A . n A 1 73 PRO 73 65 65 PRO PRO A . n A 1 74 ARG 74 66 66 ARG ARG A . n A 1 75 ASN 75 67 67 ASN ASN A . n A 1 76 PRO 76 68 68 PRO PRO A . n A 1 77 TRP 77 69 69 TRP TRP A . n A 1 78 ASN 78 70 70 ASN ASN A . n A 1 79 GLY 79 71 71 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id '2mM Rhodostomin 48ARGDWN-67NPWNG mutant-1' 2 ? mM ? 1 '2mM Rhodostomin 48ARGDWN-67NPWNG mutant-2' 2 ? mM ? 2 '2mM Rhodostomin 48ARGDWN-67NPWNG mutant-3' 2 ? mM '[U-15N]' 3 '2mM Rhodostomin 48ARGDWN-67NPWNG mutant-4' 2 ? mM '[U-15N]' 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A CYS 32 ? ? O A ALA 62 ? ? 1.52 2 1 H A ASP 5 ? ? O A CYS 19 ? ? 1.56 3 2 O A LYS 43 ? ? H A CYS 57 ? ? 1.51 4 3 HZ1 A LYS 43 ? ? O A ILE 44 ? ? 1.42 5 3 H A CYS 45 ? ? O A ASP 55 ? ? 1.48 6 3 H A ASP 5 ? ? O A CYS 19 ? ? 1.58 7 4 O A CYS 32 ? ? H A SER 39 ? ? 1.47 8 4 H A ASP 5 ? ? O A CYS 19 ? ? 1.56 9 4 O A LYS 43 ? ? H A CYS 57 ? ? 1.56 10 4 H A CYS 32 ? ? O A ALA 62 ? ? 1.58 11 4 H A ASP 15 ? ? O A LYS 20 ? ? 1.60 12 5 H A CYS 32 ? ? O A ALA 62 ? ? 1.51 13 5 H A GLY 42 ? ? O A CYS 57 ? ? 1.59 14 6 H A CYS 32 ? ? O A ALA 62 ? ? 1.50 15 7 H A ASP 5 ? ? O A CYS 19 ? ? 1.56 16 8 H A ASP 15 ? ? O A LYS 20 ? ? 1.52 17 8 H A GLY 42 ? ? O A CYS 57 ? ? 1.56 18 8 H A CYS 45 ? ? O A ASP 55 ? ? 1.57 19 8 H A ASP 5 ? ? O A CYS 19 ? ? 1.58 20 9 H A ASP 15 ? ? O A LYS 20 ? ? 1.55 21 10 O A LYS 43 ? ? H A CYS 57 ? ? 1.47 22 10 H A ASP 15 ? ? O A LYS 20 ? ? 1.55 23 10 H A CYS 32 ? ? O A ALA 62 ? ? 1.59 24 11 O A LYS 43 ? ? H A CYS 57 ? ? 1.53 25 11 H A CYS 32 ? ? O A ALA 62 ? ? 1.53 26 11 O A ARG 46 ? ? H A ASP 55 ? ? 1.58 27 11 H A CYS 45 ? ? O A ASP 55 ? ? 1.60 28 12 O A LYS 43 ? ? H A CYS 57 ? ? 1.49 29 12 H A CYS 32 ? ? O A ALA 62 ? ? 1.50 30 13 H A CYS 32 ? ? O A ALA 62 ? ? 1.57 31 13 H A GLY 42 ? ? O A CYS 57 ? ? 1.57 32 14 O A CYS 32 ? ? H A SER 39 ? ? 1.48 33 14 H A ASP 5 ? ? O A CYS 19 ? ? 1.51 34 14 O A LYS 43 ? ? H A CYS 57 ? ? 1.55 35 14 OD1 A ASN 11 ? ? H A CYS 13 ? ? 1.55 36 14 H A CYS 32 ? ? O A ALA 62 ? ? 1.58 37 15 O A LYS 43 ? ? H A CYS 57 ? ? 1.48 38 15 O A CYS 32 ? ? H A SER 39 ? ? 1.52 39 15 H A CYS 32 ? ? O A ALA 62 ? ? 1.53 40 15 OD1 A ASN 11 ? ? H A CYS 13 ? ? 1.58 41 16 O A LYS 43 ? ? H A CYS 57 ? ? 1.49 42 16 H A CYS 32 ? ? O A ALA 62 ? ? 1.52 43 16 H A CYS 45 ? ? O A ASP 55 ? ? 1.58 44 16 H A ASP 15 ? ? O A LYS 20 ? ? 1.59 45 17 H A CYS 32 ? ? O A ALA 62 ? ? 1.50 46 17 H A ASP 15 ? ? O A LYS 20 ? ? 1.52 47 17 OD1 A ASN 11 ? ? H A CYS 13 ? ? 1.58 48 17 O A LYS 43 ? ? H A CYS 57 ? ? 1.59 49 18 O A LYS 43 ? ? H A CYS 57 ? ? 1.48 50 18 H A CYS 32 ? ? O A ALA 62 ? ? 1.52 51 20 O A CYS 32 ? ? H A SER 39 ? ? 1.55 52 20 H A GLY 42 ? ? O A CYS 57 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? -153.33 30.48 2 1 CYS A 4 ? ? -175.82 129.43 3 1 CYS A 32 ? ? -98.75 31.08 4 1 SER A 39 ? ? -59.71 -173.94 5 1 ILE A 44 ? ? -54.14 85.58 6 1 ASP A 51 ? ? -175.87 55.53 7 1 TRP A 52 ? ? -124.15 -96.17 8 1 ASP A 54 ? ? -60.55 -145.95 9 1 ASP A 63 ? ? -79.79 -169.30 10 1 PRO A 68 ? ? -79.79 24.06 11 2 GLU A 3 ? ? -159.81 35.05 12 2 CYS A 19 ? ? 33.29 33.60 13 2 PRO A 23 ? ? -78.69 -160.99 14 2 SER A 39 ? ? -63.76 -117.40 15 2 ILE A 44 ? ? -57.76 98.17 16 2 ARG A 46 ? ? -160.43 110.04 17 2 ASP A 51 ? ? -159.22 44.50 18 2 ASP A 54 ? ? -67.22 -144.37 19 2 PRO A 68 ? ? -79.90 27.23 20 3 LYS A 2 ? ? -104.04 -94.96 21 3 PRO A 23 ? ? -77.64 -162.93 22 3 CYS A 27 ? ? -170.09 129.49 23 3 CYS A 32 ? ? -92.10 45.59 24 3 SER A 39 ? ? -60.82 -175.17 25 3 ILE A 44 ? ? -57.18 101.06 26 3 ASP A 51 ? ? -172.20 58.02 27 3 TRP A 52 ? ? -129.91 -106.70 28 3 ASP A 54 ? ? -66.79 -149.07 29 3 PRO A 65 ? ? -74.28 -165.89 30 3 PRO A 68 ? ? -79.92 22.55 31 3 ASN A 70 ? ? -100.52 59.46 32 4 LYS A 2 ? ? -116.60 56.93 33 4 ARG A 22 ? ? -95.62 -62.78 34 4 ILE A 44 ? ? -56.73 94.21 35 4 ASP A 51 ? ? -150.09 43.35 36 4 TRP A 69 ? ? -134.64 -88.94 37 5 PRO A 23 ? ? -78.94 -160.91 38 5 CYS A 32 ? ? -89.53 36.48 39 5 SER A 39 ? ? -60.44 -171.82 40 5 ILE A 44 ? ? -51.13 100.41 41 5 ASP A 51 ? ? 159.13 -43.89 42 5 TRP A 52 ? ? -40.51 162.44 43 5 ASP A 54 ? ? -68.29 -137.31 44 5 ASN A 70 ? ? -88.08 -94.32 45 6 GLU A 3 ? ? -143.30 14.98 46 6 PRO A 23 ? ? -79.80 -160.60 47 6 CYS A 32 ? ? -107.00 44.86 48 6 CYS A 36 ? ? 70.88 43.48 49 6 SER A 39 ? ? -60.04 -171.99 50 6 ILE A 44 ? ? -59.87 87.35 51 6 ASP A 51 ? ? -178.89 55.54 52 6 TRP A 52 ? ? -126.48 -91.47 53 6 ASP A 54 ? ? -102.52 -148.64 54 6 PRO A 68 ? ? -80.21 30.34 55 7 PRO A 23 ? ? -76.70 -159.09 56 7 CYS A 27 ? ? -170.26 142.44 57 7 CYS A 32 ? ? -142.28 52.58 58 7 SER A 39 ? ? -63.45 -136.39 59 7 ILE A 44 ? ? -54.09 88.81 60 7 ALA A 48 ? ? -118.13 -164.60 61 7 ASP A 51 ? ? 152.42 -42.82 62 7 ASN A 53 ? ? -58.35 -172.16 63 7 ASP A 54 ? ? -73.97 -146.46 64 7 ASN A 70 ? ? -125.70 -157.08 65 8 GLU A 3 ? ? -174.86 43.48 66 8 GLU A 10 ? ? -91.70 31.39 67 8 SER A 39 ? ? -60.51 -145.01 68 8 ASP A 51 ? ? -150.76 42.28 69 8 TRP A 52 ? ? -129.01 -165.63 70 8 ASP A 54 ? ? -69.74 -137.53 71 8 PRO A 68 ? ? -81.19 40.73 72 8 TRP A 69 ? ? -134.82 -95.66 73 9 LYS A 2 ? ? -141.40 38.61 74 9 GLU A 10 ? ? -91.85 39.46 75 9 CYS A 19 ? ? 34.15 35.45 76 9 CYS A 32 ? ? -108.42 64.36 77 9 SER A 39 ? ? -62.84 -135.91 78 9 ILE A 44 ? ? -67.74 83.86 79 9 ASP A 51 ? ? 171.14 -51.07 80 9 TRP A 52 ? ? -44.75 169.51 81 9 ARG A 66 ? ? -144.43 43.38 82 9 TRP A 69 ? ? -95.49 -60.78 83 10 CYS A 19 ? ? 34.83 39.82 84 10 SER A 39 ? ? -60.07 -168.81 85 10 ASP A 51 ? ? -150.70 48.92 86 10 ASP A 54 ? ? -58.27 176.79 87 10 GLN A 60 ? ? -155.56 -36.04 88 10 ASN A 70 ? ? -91.42 -97.30 89 11 LYS A 2 ? ? -89.20 -144.89 90 11 CYS A 19 ? ? 35.18 30.08 91 11 PRO A 23 ? ? -78.57 -159.53 92 11 CYS A 36 ? ? 73.03 35.58 93 11 SER A 39 ? ? -63.21 -158.11 94 11 ASP A 51 ? ? 163.82 -48.02 95 11 ASN A 53 ? ? -54.80 -176.51 96 11 PRO A 68 ? ? -79.07 42.78 97 11 ASN A 70 ? ? -116.00 70.90 98 12 LYS A 2 ? ? -115.26 -71.60 99 12 GLU A 10 ? ? -90.24 37.27 100 12 LYS A 20 ? ? -118.55 -167.57 101 12 PRO A 23 ? ? -79.37 -163.75 102 12 SER A 39 ? ? -61.25 -146.60 103 12 ILE A 44 ? ? -57.59 80.40 104 12 ASP A 51 ? ? -175.95 53.80 105 12 TRP A 52 ? ? -131.24 -106.26 106 12 ASP A 63 ? ? -79.77 -166.68 107 12 PRO A 68 ? ? -79.15 38.73 108 12 ASN A 70 ? ? -122.09 -97.86 109 13 LYS A 2 ? ? -116.69 -98.85 110 13 CYS A 19 ? ? 35.54 30.27 111 13 LYS A 20 ? ? -118.02 -168.27 112 13 PRO A 23 ? ? -78.24 -163.16 113 13 SER A 39 ? ? -59.97 -173.37 114 13 ARG A 49 ? ? -140.00 21.27 115 13 ASN A 70 ? ? -47.26 -70.77 116 14 LYS A 2 ? ? -104.05 -169.39 117 14 LYS A 20 ? ? -110.84 -152.56 118 14 SER A 39 ? ? -59.96 -156.76 119 14 ILE A 44 ? ? -53.81 87.74 120 14 ASP A 51 ? ? -164.69 48.09 121 14 ASP A 54 ? ? -71.92 -141.62 122 14 GLN A 60 ? ? -145.58 -34.44 123 14 ASP A 63 ? ? -79.25 -167.74 124 14 PRO A 68 ? ? -81.01 42.30 125 14 TRP A 69 ? ? -130.36 -96.37 126 14 ASN A 70 ? ? -53.97 105.59 127 15 PRO A 23 ? ? -77.14 -164.88 128 15 SER A 39 ? ? -66.16 -134.56 129 15 ILE A 44 ? ? -56.53 108.02 130 15 ASP A 51 ? ? 173.85 57.80 131 15 TRP A 52 ? ? -131.33 -89.62 132 15 ASN A 53 ? ? -127.19 -164.29 133 15 ARG A 66 ? ? -86.00 -140.91 134 15 PRO A 68 ? ? -80.91 40.51 135 16 CYS A 19 ? ? 35.03 33.77 136 16 PRO A 23 ? ? -79.47 -164.67 137 16 CYS A 27 ? ? -171.24 139.58 138 16 SER A 39 ? ? -60.13 -177.03 139 16 ASP A 51 ? ? -166.59 47.89 140 16 ASP A 54 ? ? -62.00 -155.54 141 16 PRO A 68 ? ? -79.97 37.48 142 17 SER A 39 ? ? -62.45 -145.68 143 17 ILE A 44 ? ? -62.09 88.09 144 17 ASP A 51 ? ? 175.98 -54.77 145 17 TRP A 52 ? ? -45.32 155.27 146 17 ASN A 53 ? ? -64.04 -179.93 147 17 ASP A 54 ? ? -69.34 -141.90 148 18 LYS A 2 ? ? -121.22 -63.71 149 18 CYS A 19 ? ? 46.37 14.84 150 18 PRO A 23 ? ? -78.83 -161.27 151 18 SER A 39 ? ? -60.06 -170.02 152 18 ARG A 46 ? ? -160.79 -169.26 153 18 ASP A 51 ? ? 172.72 56.83 154 18 TRP A 52 ? ? -125.79 -87.50 155 18 ASP A 54 ? ? -63.93 -175.84 156 19 LYS A 2 ? ? -106.57 64.76 157 19 PRO A 23 ? ? -77.77 -163.54 158 19 SER A 39 ? ? -63.10 -138.53 159 19 ILE A 44 ? ? -56.67 87.68 160 19 ASP A 51 ? ? 172.03 -51.61 161 19 TRP A 52 ? ? -48.36 159.40 162 19 ASN A 53 ? ? -60.42 -171.42 163 19 ASP A 54 ? ? -83.98 -140.43 164 19 PRO A 65 ? ? -79.70 -160.62 165 20 LYS A 2 ? ? -146.65 59.06 166 20 CYS A 19 ? ? 36.06 30.72 167 20 PRO A 23 ? ? -78.96 -160.61 168 20 SER A 39 ? ? -61.04 -139.02 169 20 ILE A 44 ? ? -53.45 88.88 170 20 ASP A 51 ? ? 162.95 -48.32 171 20 ASP A 54 ? ? -63.08 -144.50 172 20 PRO A 68 ? ? -79.82 23.23 173 20 ASN A 70 ? ? -69.08 95.56 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 22 ? ? 0.196 'SIDE CHAIN' 2 1 ARG A 40 ? ? 0.266 'SIDE CHAIN' 3 1 ARG A 46 ? ? 0.237 'SIDE CHAIN' 4 1 ARG A 49 ? ? 0.317 'SIDE CHAIN' 5 1 ARG A 56 ? ? 0.301 'SIDE CHAIN' 6 1 ARG A 66 ? ? 0.264 'SIDE CHAIN' 7 2 ARG A 22 ? ? 0.258 'SIDE CHAIN' 8 2 ARG A 40 ? ? 0.237 'SIDE CHAIN' 9 2 ARG A 46 ? ? 0.215 'SIDE CHAIN' 10 2 ARG A 49 ? ? 0.317 'SIDE CHAIN' 11 2 ARG A 56 ? ? 0.314 'SIDE CHAIN' 12 2 ARG A 66 ? ? 0.202 'SIDE CHAIN' 13 3 ARG A 22 ? ? 0.291 'SIDE CHAIN' 14 3 ARG A 40 ? ? 0.237 'SIDE CHAIN' 15 3 ARG A 46 ? ? 0.175 'SIDE CHAIN' 16 3 ARG A 49 ? ? 0.307 'SIDE CHAIN' 17 3 ARG A 56 ? ? 0.316 'SIDE CHAIN' 18 3 ARG A 66 ? ? 0.143 'SIDE CHAIN' 19 4 ARG A 22 ? ? 0.292 'SIDE CHAIN' 20 4 ARG A 40 ? ? 0.291 'SIDE CHAIN' 21 4 ARG A 46 ? ? 0.192 'SIDE CHAIN' 22 4 ARG A 49 ? ? 0.227 'SIDE CHAIN' 23 4 ARG A 56 ? ? 0.102 'SIDE CHAIN' 24 4 ARG A 66 ? ? 0.290 'SIDE CHAIN' 25 5 ARG A 22 ? ? 0.278 'SIDE CHAIN' 26 5 ARG A 40 ? ? 0.299 'SIDE CHAIN' 27 5 ARG A 46 ? ? 0.291 'SIDE CHAIN' 28 5 ARG A 49 ? ? 0.318 'SIDE CHAIN' 29 5 ARG A 56 ? ? 0.224 'SIDE CHAIN' 30 5 ARG A 66 ? ? 0.306 'SIDE CHAIN' 31 6 ARG A 22 ? ? 0.236 'SIDE CHAIN' 32 6 ARG A 40 ? ? 0.282 'SIDE CHAIN' 33 6 ARG A 46 ? ? 0.300 'SIDE CHAIN' 34 6 ARG A 49 ? ? 0.248 'SIDE CHAIN' 35 6 ARG A 56 ? ? 0.251 'SIDE CHAIN' 36 6 ARG A 66 ? ? 0.315 'SIDE CHAIN' 37 7 ARG A 22 ? ? 0.114 'SIDE CHAIN' 38 7 ARG A 40 ? ? 0.209 'SIDE CHAIN' 39 7 ARG A 46 ? ? 0.309 'SIDE CHAIN' 40 7 ARG A 49 ? ? 0.297 'SIDE CHAIN' 41 7 ARG A 56 ? ? 0.317 'SIDE CHAIN' 42 7 ARG A 66 ? ? 0.248 'SIDE CHAIN' 43 8 ARG A 22 ? ? 0.304 'SIDE CHAIN' 44 8 ARG A 46 ? ? 0.315 'SIDE CHAIN' 45 8 ARG A 49 ? ? 0.293 'SIDE CHAIN' 46 8 ARG A 56 ? ? 0.135 'SIDE CHAIN' 47 8 ARG A 66 ? ? 0.197 'SIDE CHAIN' 48 9 ARG A 22 ? ? 0.318 'SIDE CHAIN' 49 9 ARG A 40 ? ? 0.316 'SIDE CHAIN' 50 9 ARG A 46 ? ? 0.314 'SIDE CHAIN' 51 9 ARG A 49 ? ? 0.096 'SIDE CHAIN' 52 9 ARG A 56 ? ? 0.194 'SIDE CHAIN' 53 9 ARG A 66 ? ? 0.266 'SIDE CHAIN' 54 10 ARG A 22 ? ? 0.293 'SIDE CHAIN' 55 10 ARG A 40 ? ? 0.179 'SIDE CHAIN' 56 10 ARG A 46 ? ? 0.301 'SIDE CHAIN' 57 10 ARG A 49 ? ? 0.310 'SIDE CHAIN' 58 10 ARG A 56 ? ? 0.250 'SIDE CHAIN' 59 10 ARG A 66 ? ? 0.161 'SIDE CHAIN' 60 11 ARG A 22 ? ? 0.270 'SIDE CHAIN' 61 11 ARG A 40 ? ? 0.207 'SIDE CHAIN' 62 11 ARG A 46 ? ? 0.305 'SIDE CHAIN' 63 11 ARG A 49 ? ? 0.269 'SIDE CHAIN' 64 11 ARG A 56 ? ? 0.255 'SIDE CHAIN' 65 11 ARG A 66 ? ? 0.315 'SIDE CHAIN' 66 12 ARG A 22 ? ? 0.179 'SIDE CHAIN' 67 12 ARG A 40 ? ? 0.245 'SIDE CHAIN' 68 12 ARG A 46 ? ? 0.296 'SIDE CHAIN' 69 12 ARG A 49 ? ? 0.202 'SIDE CHAIN' 70 12 ARG A 56 ? ? 0.079 'SIDE CHAIN' 71 12 ARG A 66 ? ? 0.317 'SIDE CHAIN' 72 13 ARG A 22 ? ? 0.230 'SIDE CHAIN' 73 13 ARG A 40 ? ? 0.229 'SIDE CHAIN' 74 13 ARG A 46 ? ? 0.283 'SIDE CHAIN' 75 13 ARG A 49 ? ? 0.211 'SIDE CHAIN' 76 13 ARG A 56 ? ? 0.158 'SIDE CHAIN' 77 13 ARG A 66 ? ? 0.198 'SIDE CHAIN' 78 14 ARG A 22 ? ? 0.310 'SIDE CHAIN' 79 14 ARG A 40 ? ? 0.313 'SIDE CHAIN' 80 14 ARG A 46 ? ? 0.317 'SIDE CHAIN' 81 14 ARG A 49 ? ? 0.096 'SIDE CHAIN' 82 14 ARG A 56 ? ? 0.308 'SIDE CHAIN' 83 14 ARG A 66 ? ? 0.305 'SIDE CHAIN' 84 15 ARG A 22 ? ? 0.122 'SIDE CHAIN' 85 15 ARG A 40 ? ? 0.238 'SIDE CHAIN' 86 15 ARG A 46 ? ? 0.169 'SIDE CHAIN' 87 15 ARG A 49 ? ? 0.301 'SIDE CHAIN' 88 15 ARG A 56 ? ? 0.316 'SIDE CHAIN' 89 15 ARG A 66 ? ? 0.234 'SIDE CHAIN' 90 16 ARG A 22 ? ? 0.317 'SIDE CHAIN' 91 16 ARG A 49 ? ? 0.263 'SIDE CHAIN' 92 16 ARG A 56 ? ? 0.153 'SIDE CHAIN' 93 16 ARG A 66 ? ? 0.313 'SIDE CHAIN' 94 17 ARG A 22 ? ? 0.150 'SIDE CHAIN' 95 17 ARG A 40 ? ? 0.299 'SIDE CHAIN' 96 17 ARG A 46 ? ? 0.261 'SIDE CHAIN' 97 17 ARG A 49 ? ? 0.195 'SIDE CHAIN' 98 17 ARG A 56 ? ? 0.317 'SIDE CHAIN' 99 17 ARG A 66 ? ? 0.318 'SIDE CHAIN' 100 18 ARG A 22 ? ? 0.317 'SIDE CHAIN' 101 18 ARG A 40 ? ? 0.197 'SIDE CHAIN' 102 18 ARG A 46 ? ? 0.309 'SIDE CHAIN' 103 18 ARG A 49 ? ? 0.246 'SIDE CHAIN' 104 18 ARG A 56 ? ? 0.274 'SIDE CHAIN' 105 18 ARG A 66 ? ? 0.248 'SIDE CHAIN' 106 19 ARG A 22 ? ? 0.113 'SIDE CHAIN' 107 19 ARG A 40 ? ? 0.279 'SIDE CHAIN' 108 19 ARG A 46 ? ? 0.246 'SIDE CHAIN' 109 19 ARG A 49 ? ? 0.276 'SIDE CHAIN' 110 19 ARG A 56 ? ? 0.259 'SIDE CHAIN' 111 19 ARG A 66 ? ? 0.160 'SIDE CHAIN' 112 20 ARG A 22 ? ? 0.290 'SIDE CHAIN' 113 20 ARG A 40 ? ? 0.116 'SIDE CHAIN' 114 20 ARG A 46 ? ? 0.262 'SIDE CHAIN' 115 20 ARG A 49 ? ? 0.315 'SIDE CHAIN' 116 20 ARG A 56 ? ? 0.245 'SIDE CHAIN' 117 20 ARG A 66 ? ? 0.280 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU -7 ? A GLU 1 2 1 Y 1 A PHE -6 ? A PHE 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 2 Y 1 A GLU -7 ? A GLU 1 10 2 Y 1 A PHE -6 ? A PHE 2 11 2 Y 1 A HIS -5 ? A HIS 3 12 2 Y 1 A HIS -4 ? A HIS 4 13 2 Y 1 A HIS -3 ? A HIS 5 14 2 Y 1 A HIS -2 ? A HIS 6 15 2 Y 1 A HIS -1 ? A HIS 7 16 2 Y 1 A HIS 0 ? A HIS 8 17 3 Y 1 A GLU -7 ? A GLU 1 18 3 Y 1 A PHE -6 ? A PHE 2 19 3 Y 1 A HIS -5 ? A HIS 3 20 3 Y 1 A HIS -4 ? A HIS 4 21 3 Y 1 A HIS -3 ? A HIS 5 22 3 Y 1 A HIS -2 ? A HIS 6 23 3 Y 1 A HIS -1 ? A HIS 7 24 3 Y 1 A HIS 0 ? A HIS 8 25 4 Y 1 A GLU -7 ? A GLU 1 26 4 Y 1 A PHE -6 ? A PHE 2 27 4 Y 1 A HIS -5 ? A HIS 3 28 4 Y 1 A HIS -4 ? A HIS 4 29 4 Y 1 A HIS -3 ? A HIS 5 30 4 Y 1 A HIS -2 ? A HIS 6 31 4 Y 1 A HIS -1 ? A HIS 7 32 4 Y 1 A HIS 0 ? A HIS 8 33 5 Y 1 A GLU -7 ? A GLU 1 34 5 Y 1 A PHE -6 ? A PHE 2 35 5 Y 1 A HIS -5 ? A HIS 3 36 5 Y 1 A HIS -4 ? A HIS 4 37 5 Y 1 A HIS -3 ? A HIS 5 38 5 Y 1 A HIS -2 ? A HIS 6 39 5 Y 1 A HIS -1 ? A HIS 7 40 5 Y 1 A HIS 0 ? A HIS 8 41 6 Y 1 A GLU -7 ? A GLU 1 42 6 Y 1 A PHE -6 ? A PHE 2 43 6 Y 1 A HIS -5 ? A HIS 3 44 6 Y 1 A HIS -4 ? A HIS 4 45 6 Y 1 A HIS -3 ? A HIS 5 46 6 Y 1 A HIS -2 ? A HIS 6 47 6 Y 1 A HIS -1 ? A HIS 7 48 6 Y 1 A HIS 0 ? A HIS 8 49 7 Y 1 A GLU -7 ? A GLU 1 50 7 Y 1 A PHE -6 ? A PHE 2 51 7 Y 1 A HIS -5 ? A HIS 3 52 7 Y 1 A HIS -4 ? A HIS 4 53 7 Y 1 A HIS -3 ? A HIS 5 54 7 Y 1 A HIS -2 ? A HIS 6 55 7 Y 1 A HIS -1 ? A HIS 7 56 7 Y 1 A HIS 0 ? A HIS 8 57 8 Y 1 A GLU -7 ? A GLU 1 58 8 Y 1 A PHE -6 ? A PHE 2 59 8 Y 1 A HIS -5 ? A HIS 3 60 8 Y 1 A HIS -4 ? A HIS 4 61 8 Y 1 A HIS -3 ? A HIS 5 62 8 Y 1 A HIS -2 ? A HIS 6 63 8 Y 1 A HIS -1 ? A HIS 7 64 8 Y 1 A HIS 0 ? A HIS 8 65 9 Y 1 A GLU -7 ? A GLU 1 66 9 Y 1 A PHE -6 ? A PHE 2 67 9 Y 1 A HIS -5 ? A HIS 3 68 9 Y 1 A HIS -4 ? A HIS 4 69 9 Y 1 A HIS -3 ? A HIS 5 70 9 Y 1 A HIS -2 ? A HIS 6 71 9 Y 1 A HIS -1 ? A HIS 7 72 9 Y 1 A HIS 0 ? A HIS 8 73 10 Y 1 A GLU -7 ? A GLU 1 74 10 Y 1 A PHE -6 ? A PHE 2 75 10 Y 1 A HIS -5 ? A HIS 3 76 10 Y 1 A HIS -4 ? A HIS 4 77 10 Y 1 A HIS -3 ? A HIS 5 78 10 Y 1 A HIS -2 ? A HIS 6 79 10 Y 1 A HIS -1 ? A HIS 7 80 10 Y 1 A HIS 0 ? A HIS 8 81 11 Y 1 A GLU -7 ? A GLU 1 82 11 Y 1 A PHE -6 ? A PHE 2 83 11 Y 1 A HIS -5 ? A HIS 3 84 11 Y 1 A HIS -4 ? A HIS 4 85 11 Y 1 A HIS -3 ? A HIS 5 86 11 Y 1 A HIS -2 ? A HIS 6 87 11 Y 1 A HIS -1 ? A HIS 7 88 11 Y 1 A HIS 0 ? A HIS 8 89 12 Y 1 A GLU -7 ? A GLU 1 90 12 Y 1 A PHE -6 ? A PHE 2 91 12 Y 1 A HIS -5 ? A HIS 3 92 12 Y 1 A HIS -4 ? A HIS 4 93 12 Y 1 A HIS -3 ? A HIS 5 94 12 Y 1 A HIS -2 ? A HIS 6 95 12 Y 1 A HIS -1 ? A HIS 7 96 12 Y 1 A HIS 0 ? A HIS 8 97 13 Y 1 A GLU -7 ? A GLU 1 98 13 Y 1 A PHE -6 ? A PHE 2 99 13 Y 1 A HIS -5 ? A HIS 3 100 13 Y 1 A HIS -4 ? A HIS 4 101 13 Y 1 A HIS -3 ? A HIS 5 102 13 Y 1 A HIS -2 ? A HIS 6 103 13 Y 1 A HIS -1 ? A HIS 7 104 13 Y 1 A HIS 0 ? A HIS 8 105 14 Y 1 A GLU -7 ? A GLU 1 106 14 Y 1 A PHE -6 ? A PHE 2 107 14 Y 1 A HIS -5 ? A HIS 3 108 14 Y 1 A HIS -4 ? A HIS 4 109 14 Y 1 A HIS -3 ? A HIS 5 110 14 Y 1 A HIS -2 ? A HIS 6 111 14 Y 1 A HIS -1 ? A HIS 7 112 14 Y 1 A HIS 0 ? A HIS 8 113 15 Y 1 A GLU -7 ? A GLU 1 114 15 Y 1 A PHE -6 ? A PHE 2 115 15 Y 1 A HIS -5 ? A HIS 3 116 15 Y 1 A HIS -4 ? A HIS 4 117 15 Y 1 A HIS -3 ? A HIS 5 118 15 Y 1 A HIS -2 ? A HIS 6 119 15 Y 1 A HIS -1 ? A HIS 7 120 15 Y 1 A HIS 0 ? A HIS 8 121 16 Y 1 A GLU -7 ? A GLU 1 122 16 Y 1 A PHE -6 ? A PHE 2 123 16 Y 1 A HIS -5 ? A HIS 3 124 16 Y 1 A HIS -4 ? A HIS 4 125 16 Y 1 A HIS -3 ? A HIS 5 126 16 Y 1 A HIS -2 ? A HIS 6 127 16 Y 1 A HIS -1 ? A HIS 7 128 16 Y 1 A HIS 0 ? A HIS 8 129 17 Y 1 A GLU -7 ? A GLU 1 130 17 Y 1 A PHE -6 ? A PHE 2 131 17 Y 1 A HIS -5 ? A HIS 3 132 17 Y 1 A HIS -4 ? A HIS 4 133 17 Y 1 A HIS -3 ? A HIS 5 134 17 Y 1 A HIS -2 ? A HIS 6 135 17 Y 1 A HIS -1 ? A HIS 7 136 17 Y 1 A HIS 0 ? A HIS 8 137 18 Y 1 A GLU -7 ? A GLU 1 138 18 Y 1 A PHE -6 ? A PHE 2 139 18 Y 1 A HIS -5 ? A HIS 3 140 18 Y 1 A HIS -4 ? A HIS 4 141 18 Y 1 A HIS -3 ? A HIS 5 142 18 Y 1 A HIS -2 ? A HIS 6 143 18 Y 1 A HIS -1 ? A HIS 7 144 18 Y 1 A HIS 0 ? A HIS 8 145 19 Y 1 A GLU -7 ? A GLU 1 146 19 Y 1 A PHE -6 ? A PHE 2 147 19 Y 1 A HIS -5 ? A HIS 3 148 19 Y 1 A HIS -4 ? A HIS 4 149 19 Y 1 A HIS -3 ? A HIS 5 150 19 Y 1 A HIS -2 ? A HIS 6 151 19 Y 1 A HIS -1 ? A HIS 7 152 19 Y 1 A HIS 0 ? A HIS 8 153 20 Y 1 A GLU -7 ? A GLU 1 154 20 Y 1 A PHE -6 ? A PHE 2 155 20 Y 1 A HIS -5 ? A HIS 3 156 20 Y 1 A HIS -4 ? A HIS 4 157 20 Y 1 A HIS -3 ? A HIS 5 158 20 Y 1 A HIS -2 ? A HIS 6 159 20 Y 1 A HIS -1 ? A HIS 7 160 20 Y 1 A HIS 0 ? A HIS 8 #