data_2M7M # _entry.id 2M7M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M7M pdb_00002m7m 10.2210/pdb2m7m/pdb RCSB RCSB103310 ? ? BMRB 19196 ? 10.13018/BMR19196 WWPDB D_1000103310 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-19 2 'Structure model' 1 1 2013-07-03 3 'Structure model' 1 2 2013-08-28 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 28 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M7M _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19196 BMRB unspecified . 2M7N PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chary, K.V.' 1 'Rout, A.K.' 2 'Patel, S.' 3 'Bhattacharya, A.' 4 # _citation.id primary _citation.title 'Functional Manipulation of a Calcium-binding Protein from Entamoeba histolytica Guided by Paramagnetic NMR.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 23473 _citation.page_last 23487 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23782698 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.411058 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rout, A.K.' 1 ? primary 'Patel, S.' 2 ? primary Somlata 3 ? primary 'Shukla, M.' 4 ? primary 'Saraswathi, D.' 5 ? primary 'Bhattacharya, A.' 6 ? primary 'Chary, K.V.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-binding protein' 7380.256 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CABP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQ _entity_poly.pdbx_seq_one_letter_code_can MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ALA n 1 5 LEU n 1 6 PHE n 1 7 LYS n 1 8 GLU n 1 9 ILE n 1 10 ASP n 1 11 VAL n 1 12 ASN n 1 13 GLY n 1 14 ASP n 1 15 GLY n 1 16 ALA n 1 17 VAL n 1 18 SER n 1 19 TYR n 1 20 GLU n 1 21 GLU n 1 22 VAL n 1 23 LYS n 1 24 ALA n 1 25 PHE n 1 26 VAL n 1 27 SER n 1 28 LYS n 1 29 LYS n 1 30 ARG n 1 31 ALA n 1 32 ILE n 1 33 LYS n 1 34 ASN n 1 35 GLU n 1 36 GLN n 1 37 LEU n 1 38 LEU n 1 39 GLN n 1 40 LEU n 1 41 ILE n 1 42 PHE n 1 43 LYS n 1 44 SER n 1 45 ILE n 1 46 ASP n 1 47 ALA n 1 48 ASP n 1 49 GLY n 1 50 ASN n 1 51 GLY n 1 52 GLU n 1 53 ILE n 1 54 ASP n 1 55 GLN n 1 56 ASN n 1 57 GLU n 1 58 PHE n 1 59 ALA n 1 60 LYS n 1 61 PHE n 1 62 TYR n 1 63 GLY n 1 64 SER n 1 65 ILE n 1 66 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Entamoeba histolytica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5759 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET30a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLN 66 66 66 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 250 CA CA A . C 2 CA 1 102 300 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M7M _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M7M _struct.title 'N-terminal domain of EhCaBP1 structure' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M7M _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Protein, CALCIUM BINDING PROTEIN, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALBP_ENTHI _struct_ref.pdbx_db_accession P38505 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M7M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38505 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 3 ? ASP A 10 ? GLU A 3 ASP A 10 1 ? 8 HELX_P HELX_P2 2 TYR A 19 ? LYS A 28 ? TYR A 19 LYS A 28 1 ? 10 HELX_P HELX_P3 3 ASN A 34 ? ASP A 46 ? ASN A 34 ASP A 46 1 ? 13 HELX_P HELX_P4 4 GLN A 55 ? TYR A 62 ? GLN A 55 TYR A 62 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 10 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 10 A CA 101 1_555 ? ? ? ? ? ? ? 0.943 ? ? metalc2 metalc ? ? A ASP 10 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 10 A CA 101 1_555 ? ? ? ? ? ? ? 2.845 ? ? metalc3 metalc ? ? A ASN 12 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 12 A CA 101 1_555 ? ? ? ? ? ? ? 2.494 ? ? metalc4 metalc ? ? A ASN 12 HD22 ? ? ? 1_555 B CA . CA ? ? A ASN 12 A CA 101 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc5 metalc ? ? A ASP 14 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 14 A CA 101 1_555 ? ? ? ? ? ? ? 2.819 ? ? metalc6 metalc ? ? A ASP 14 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 14 A CA 101 1_555 ? ? ? ? ? ? ? 2.612 ? ? metalc7 metalc ? ? A ALA 16 O ? ? ? 1_555 B CA . CA ? ? A ALA 16 A CA 101 1_555 ? ? ? ? ? ? ? 2.644 ? ? metalc8 metalc ? ? A GLU 21 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 21 A CA 101 1_555 ? ? ? ? ? ? ? 2.862 ? ? metalc9 metalc ? ? A GLU 21 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 21 A CA 101 1_555 ? ? ? ? ? ? ? 2.842 ? ? metalc10 metalc ? ? A ASP 46 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 46 A CA 102 1_555 ? ? ? ? ? ? ? 3.453 ? ? metalc11 metalc ? ? A ASP 46 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 46 A CA 102 1_555 ? ? ? ? ? ? ? 3.074 ? ? metalc12 metalc ? ? A ASP 48 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 48 A CA 102 1_555 ? ? ? ? ? ? ? 2.719 ? ? metalc13 metalc ? ? A ASN 50 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 50 A CA 102 1_555 ? ? ? ? ? ? ? 1.542 ? ? metalc14 metalc ? ? A ASP 54 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 54 A CA 102 1_555 ? ? ? ? ? ? ? 3.634 ? ? metalc15 metalc ? ? A ASP 54 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 54 A CA 102 1_555 ? ? ? ? ? ? ? 2.847 ? ? metalc16 metalc ? ? A GLU 57 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 57 A CA 102 1_555 ? ? ? ? ? ? ? 2.879 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 39.3 ? 2 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 98.7 ? 3 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 106.3 ? 4 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 149.4 ? 5 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 164.3 ? 6 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 63.7 ? 7 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 140.0 ? 8 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 106.8 ? 9 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 66.4 ? 10 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 58.7 ? 11 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 92.4 ? 12 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 64.1 ? 13 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 63.1 ? 14 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 100.3 ? 15 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 47.6 ? 16 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ALA 16 ? A ALA 16 ? 1_555 96.8 ? 17 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ALA 16 ? A ALA 16 ? 1_555 61.4 ? 18 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ALA 16 ? A ALA 16 ? 1_555 127.8 ? 19 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ALA 16 ? A ALA 16 ? 1_555 113.8 ? 20 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ALA 16 ? A ALA 16 ? 1_555 69.8 ? 21 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ALA 16 ? A ALA 16 ? 1_555 66.6 ? 22 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 63.7 ? 23 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 84.3 ? 24 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 137.7 ? 25 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 111.2 ? 26 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 150.5 ? 27 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 147.8 ? 28 O ? A ALA 16 ? A ALA 16 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 93.6 ? 29 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 98.8 ? 30 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 129.1 ? 31 OD1 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 108.0 ? 32 HD22 ? A ASN 12 ? A ASN 12 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 66.6 ? 33 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 120.9 ? 34 OD1 ? A ASP 14 ? A ASP 14 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 166.8 ? 35 O ? A ALA 16 ? A ALA 16 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 118.4 ? 36 OE1 ? A GLU 21 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 21 ? A GLU 21 ? 1_555 45.3 ? 37 OD2 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 38.8 ? 38 OD2 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 48 ? A ASP 48 ? 1_555 76.9 ? 39 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 48 ? A ASP 48 ? 1_555 53.1 ? 40 OD2 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 91.1 ? 41 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 105.5 ? 42 OD1 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 68.7 ? 43 OD2 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 54 ? A ASP 54 ? 1_555 154.8 ? 44 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 54 ? A ASP 54 ? 1_555 118.0 ? 45 OD1 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 54 ? A ASP 54 ? 1_555 95.3 ? 46 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 54 ? A ASP 54 ? 1_555 108.6 ? 47 OD2 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 54 ? A ASP 54 ? 1_555 140.8 ? 48 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 54 ? A ASP 54 ? 1_555 131.0 ? 49 OD1 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 54 ? A ASP 54 ? 1_555 132.1 ? 50 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 54 ? A ASP 54 ? 1_555 121.7 ? 51 OD2 ? A ASP 54 ? A ASP 54 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 54 ? A ASP 54 ? 1_555 37.2 ? 52 OD2 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 86.2 ? 53 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 50.8 ? 54 OD1 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 67.5 ? 55 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 135.5 ? 56 OD2 ? A ASP 54 ? A ASP 54 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 68.7 ? 57 OD1 ? A ASP 54 ? A ASP 54 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 84.0 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 16 ? SER A 18 ? ALA A 16 SER A 18 A 2 GLU A 52 ? ASP A 54 ? GLU A 52 ASP A 54 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 17 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 17 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 53 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 53 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 5 'BINDING SITE FOR RESIDUE CA A 101' AC2 Software A CA 102 ? 7 'BINDING SITE FOR RESIDUE CA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 10 ? ASP A 10 . ? 1_555 ? 2 AC1 5 ASN A 12 ? ASN A 12 . ? 1_555 ? 3 AC1 5 ASP A 14 ? ASP A 14 . ? 1_555 ? 4 AC1 5 ALA A 16 ? ALA A 16 . ? 1_555 ? 5 AC1 5 GLU A 21 ? GLU A 21 . ? 1_555 ? 6 AC2 7 ASP A 46 ? ASP A 46 . ? 1_555 ? 7 AC2 7 ASP A 48 ? ASP A 48 . ? 1_555 ? 8 AC2 7 ASN A 50 ? ASN A 50 . ? 1_555 ? 9 AC2 7 GLU A 52 ? GLU A 52 . ? 1_555 ? 10 AC2 7 ILE A 53 ? ILE A 53 . ? 1_555 ? 11 AC2 7 ASP A 54 ? ASP A 54 . ? 1_555 ? 12 AC2 7 GLU A 57 ? GLU A 57 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 8 O A ASN 50 ? ? H A GLU 52 ? ? 1.60 2 10 O A ASN 50 ? ? H A GLU 52 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -178.15 -169.71 2 1 ARG A 30 ? ? -175.59 -173.80 3 3 ALA A 2 ? ? -120.77 -68.42 4 3 ARG A 30 ? ? -175.55 -174.01 5 4 ALA A 2 ? ? -119.17 -70.67 6 4 ARG A 30 ? ? -175.87 -173.69 7 5 ALA A 2 ? ? -129.63 -71.47 8 5 ARG A 30 ? ? -176.24 -173.91 9 6 ALA A 2 ? ? -122.86 -68.72 10 6 ARG A 30 ? ? -176.22 -173.81 11 7 ARG A 30 ? ? -175.48 -173.50 12 8 ALA A 2 ? ? -148.84 -75.23 13 8 ARG A 30 ? ? -176.11 -173.16 14 9 ARG A 30 ? ? -176.25 -173.45 15 10 ALA A 2 ? ? -116.90 -73.51 16 10 ARG A 30 ? ? -175.99 -173.89 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M7M _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M7M _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.8 mM [U-99% 15N] (Y81F)-EhCaBP1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8 mM [U-99% 13C; U-99% 15N] (Y81F)-EhCaBP1, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.8 mM [U-99% 13C; U-99% 15N] (Y81F)-EhCaBP1, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id '(Y81F)-EhCaBP1-1' 0.8 ? mM '[U-99% 15N]' 1 '(Y81F)-EhCaBP1-2' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 2 '(Y81F)-EhCaBP1-3' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC' 1 3 2 '3D HNCO' 1 4 2 '3D HNCACB' 1 5 2 '3D 1H-15N TOCSY' 1 6 2 '3D 1H-15N NOESY' 1 7 2 '3D HCCH-TOCSY' 1 8 3 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2M7M _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 'Bruker Biospin' 'data analysis' TopSpin ? 3 'Accelrys Software Inc.' processing Felix ? 4 'Accelrys Software Inc.' 'data analysis' Felix ? 5 'Keller and Wuthrich' 'data analysis' CARA ? 6 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 7 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 8 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 SER N N N N 236 SER CA C N S 237 SER C C N N 238 SER O O N N 239 SER CB C N N 240 SER OG O N N 241 SER OXT O N N 242 SER H H N N 243 SER H2 H N N 244 SER HA H N N 245 SER HB2 H N N 246 SER HB3 H N N 247 SER HG H N N 248 SER HXT H N N 249 TYR N N N N 250 TYR CA C N S 251 TYR C C N N 252 TYR O O N N 253 TYR CB C N N 254 TYR CG C Y N 255 TYR CD1 C Y N 256 TYR CD2 C Y N 257 TYR CE1 C Y N 258 TYR CE2 C Y N 259 TYR CZ C Y N 260 TYR OH O N N 261 TYR OXT O N N 262 TYR H H N N 263 TYR H2 H N N 264 TYR HA H N N 265 TYR HB2 H N N 266 TYR HB3 H N N 267 TYR HD1 H N N 268 TYR HD2 H N N 269 TYR HE1 H N N 270 TYR HE2 H N N 271 TYR HH H N N 272 TYR HXT H N N 273 VAL N N N N 274 VAL CA C N S 275 VAL C C N N 276 VAL O O N N 277 VAL CB C N N 278 VAL CG1 C N N 279 VAL CG2 C N N 280 VAL OXT O N N 281 VAL H H N N 282 VAL H2 H N N 283 VAL HA H N N 284 VAL HB H N N 285 VAL HG11 H N N 286 VAL HG12 H N N 287 VAL HG13 H N N 288 VAL HG21 H N N 289 VAL HG22 H N N 290 VAL HG23 H N N 291 VAL HXT H N N 292 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 TYR N CA sing N N 237 TYR N H sing N N 238 TYR N H2 sing N N 239 TYR CA C sing N N 240 TYR CA CB sing N N 241 TYR CA HA sing N N 242 TYR C O doub N N 243 TYR C OXT sing N N 244 TYR CB CG sing N N 245 TYR CB HB2 sing N N 246 TYR CB HB3 sing N N 247 TYR CG CD1 doub Y N 248 TYR CG CD2 sing Y N 249 TYR CD1 CE1 sing Y N 250 TYR CD1 HD1 sing N N 251 TYR CD2 CE2 doub Y N 252 TYR CD2 HD2 sing N N 253 TYR CE1 CZ doub Y N 254 TYR CE1 HE1 sing N N 255 TYR CE2 CZ sing Y N 256 TYR CE2 HE2 sing N N 257 TYR CZ OH sing N N 258 TYR OH HH sing N N 259 TYR OXT HXT sing N N 260 VAL N CA sing N N 261 VAL N H sing N N 262 VAL N H2 sing N N 263 VAL CA C sing N N 264 VAL CA CB sing N N 265 VAL CA HA sing N N 266 VAL C O doub N N 267 VAL C OXT sing N N 268 VAL CB CG1 sing N N 269 VAL CB CG2 sing N N 270 VAL CB HB sing N N 271 VAL CG1 HG11 sing N N 272 VAL CG1 HG12 sing N N 273 VAL CG1 HG13 sing N N 274 VAL CG2 HG21 sing N N 275 VAL CG2 HG22 sing N N 276 VAL CG2 HG23 sing N N 277 VAL OXT HXT sing N N 278 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2M7M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_