data_2M7N # _entry.id 2M7N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M7N pdb_00002m7n 10.2210/pdb2m7n/pdb RCSB RCSB103311 ? ? BMRB 19197 ? ? WWPDB D_1000103311 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19197 BMRB unspecified . 2M7M PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M7N _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chary, K.V.' 1 'Rout, A.K.' 2 'Patel, S.' 3 'Bhattacharya, A.' 4 # _citation.id primary _citation.title 'Functional Manipulation of a Calcium-binding Protein from Entamoeba histolytica Guided by Paramagnetic NMR.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 23473 _citation.page_last 23487 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23782698 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.411058 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rout, A.K.' 1 ? primary 'Patel, S.' 2 ? primary Somlata 3 ? primary 'Shukla, M.' 4 ? primary 'Saraswathi, D.' 5 ? primary 'Bhattacharya, A.' 6 ? primary 'Chary, K.V.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-binding protein' 14954.852 1 ? Y81F ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CABP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVL FKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVL FKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ALA n 1 5 LEU n 1 6 PHE n 1 7 LYS n 1 8 GLU n 1 9 ILE n 1 10 ASP n 1 11 VAL n 1 12 ASN n 1 13 GLY n 1 14 ASP n 1 15 GLY n 1 16 ALA n 1 17 VAL n 1 18 SER n 1 19 TYR n 1 20 GLU n 1 21 GLU n 1 22 VAL n 1 23 LYS n 1 24 ALA n 1 25 PHE n 1 26 VAL n 1 27 SER n 1 28 LYS n 1 29 LYS n 1 30 ARG n 1 31 ALA n 1 32 ILE n 1 33 LYS n 1 34 ASN n 1 35 GLU n 1 36 GLN n 1 37 LEU n 1 38 LEU n 1 39 GLN n 1 40 LEU n 1 41 ILE n 1 42 PHE n 1 43 LYS n 1 44 SER n 1 45 ILE n 1 46 ASP n 1 47 ALA n 1 48 ASP n 1 49 GLY n 1 50 ASN n 1 51 GLY n 1 52 GLU n 1 53 ILE n 1 54 ASP n 1 55 GLN n 1 56 ASN n 1 57 GLU n 1 58 PHE n 1 59 ALA n 1 60 LYS n 1 61 PHE n 1 62 TYR n 1 63 GLY n 1 64 SER n 1 65 ILE n 1 66 GLN n 1 67 GLY n 1 68 GLN n 1 69 ASP n 1 70 LEU n 1 71 SER n 1 72 ASP n 1 73 ASP n 1 74 LYS n 1 75 ILE n 1 76 GLY n 1 77 LEU n 1 78 LYS n 1 79 VAL n 1 80 LEU n 1 81 PHE n 1 82 LYS n 1 83 LEU n 1 84 MET n 1 85 ASP n 1 86 VAL n 1 87 ASP n 1 88 GLY n 1 89 ASP n 1 90 GLY n 1 91 LYS n 1 92 LEU n 1 93 THR n 1 94 LYS n 1 95 GLU n 1 96 GLU n 1 97 VAL n 1 98 THR n 1 99 SER n 1 100 PHE n 1 101 PHE n 1 102 LYS n 1 103 LYS n 1 104 HIS n 1 105 GLY n 1 106 ILE n 1 107 GLU n 1 108 LYS n 1 109 VAL n 1 110 ALA n 1 111 GLU n 1 112 GLN n 1 113 VAL n 1 114 MET n 1 115 LYS n 1 116 ALA n 1 117 ASP n 1 118 ALA n 1 119 ASN n 1 120 GLY n 1 121 ASP n 1 122 GLY n 1 123 TYR n 1 124 ILE n 1 125 THR n 1 126 LEU n 1 127 GLU n 1 128 GLU n 1 129 PHE n 1 130 LEU n 1 131 GLU n 1 132 PHE n 1 133 SER n 1 134 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Entamoeba histolytica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5759 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET30a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALBP_ENTHI _struct_ref.pdbx_db_accession P38505 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVL YKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M7N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38505 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2M7N _struct_ref_seq_dif.mon_id PHE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 81 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P38505 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 81 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 81 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC' 1 3 2 '3D HNCO' 1 4 2 '3D HNCACB' 1 5 2 '3D 1H-15N TOCSY' 1 6 2 '3D HCCH-TOCSY' 1 7 3 '3D 1H-13C NOESY' 1 8 2 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.8 mM [U-99% 15N] (Y81F)-EhCaBP1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8 mM [U-99% 13C; U-99% 15N] (Y81F)-EhCaBP1, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.8 mM [U-99% 13C; U-99% 15N] (Y81F)-EhCaBP1, 100% D2O' 3 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M7N _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M7N _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M7N _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 'Bruker Biospin' 'data analysis' TopSpin ? 3 'Accelrys Software Inc.' processing Felix ? 4 'Accelrys Software Inc.' 'data analysis' Felix ? 5 'Accelrys Software Inc.' 'peak picking' Felix ? 6 'Keller and Wuthrich' 'data analysis' CARA ? 7 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 8 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 9 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M7N _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M7N _struct.title 'C-terminal structure of (Y81F)-EhCaBP1' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M7N _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Protein, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 74 ? MET A 84 ? LYS A 74 MET A 84 1 ? 11 HELX_P HELX_P2 2 LYS A 94 ? LYS A 103 ? LYS A 94 LYS A 103 1 ? 10 HELX_P HELX_P3 3 LYS A 108 ? ASP A 117 ? LYS A 108 ASP A 117 1 ? 10 HELX_P HELX_P4 4 LEU A 126 ? PHE A 132 ? LEU A 126 PHE A 132 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 85 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 85 A CA 201 1_555 ? ? ? ? ? ? ? 3.007 ? ? metalc2 metalc ? ? A ASP 85 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 85 A CA 201 1_555 ? ? ? ? ? ? ? 1.010 ? ? metalc3 metalc ? ? A ASP 87 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 87 A CA 201 1_555 ? ? ? ? ? ? ? 2.907 ? ? metalc4 metalc ? ? A ASP 87 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 87 A CA 201 1_555 ? ? ? ? ? ? ? 2.888 ? ? metalc5 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 89 A CA 201 1_555 ? ? ? ? ? ? ? 2.988 ? ? metalc6 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 89 A CA 201 1_555 ? ? ? ? ? ? ? 2.780 ? ? metalc7 metalc ? ? A LYS 91 O ? ? ? 1_555 B CA . CA ? ? A LYS 91 A CA 201 1_555 ? ? ? ? ? ? ? 3.039 ? ? metalc8 metalc ? ? A GLU 96 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 96 A CA 201 1_555 ? ? ? ? ? ? ? 2.812 ? ? metalc9 metalc ? ? A GLU 96 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 96 A CA 201 1_555 ? ? ? ? ? ? ? 2.744 ? ? metalc10 metalc ? ? A ASP 117 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 117 A CA 202 1_555 ? ? ? ? ? ? ? 2.817 ? ? metalc11 metalc ? ? A ASP 117 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 117 A CA 202 1_555 ? ? ? ? ? ? ? 2.834 ? ? metalc12 metalc ? ? A ASN 119 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 119 A CA 202 1_555 ? ? ? ? ? ? ? 2.161 ? ? metalc13 metalc ? ? A ASP 121 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 121 A CA 202 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc14 metalc ? ? A ASP 121 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 121 A CA 202 1_555 ? ? ? ? ? ? ? 2.261 ? ? metalc15 metalc ? ? A TYR 123 O ? ? ? 1_555 C CA . CA ? ? A TYR 123 A CA 202 1_555 ? ? ? ? ? ? ? 3.011 ? ? metalc16 metalc ? ? A GLU 128 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 128 A CA 202 1_555 ? ? ? ? ? ? ? 2.803 ? ? metalc17 metalc ? ? A GLU 128 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 128 A CA 202 1_555 ? ? ? ? ? ? ? 2.948 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 91 ? THR A 93 ? LYS A 91 THR A 93 A 2 TYR A 123 ? THR A 125 ? TYR A 123 THR A 125 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 92 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 92 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 124 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 124 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 5 'BINDING SITE FOR RESIDUE CA A 201' AC2 Software A CA 202 ? 5 'BINDING SITE FOR RESIDUE CA A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 85 ? ASP A 85 . ? 1_555 ? 2 AC1 5 ASP A 87 ? ASP A 87 . ? 1_555 ? 3 AC1 5 ASP A 89 ? ASP A 89 . ? 1_555 ? 4 AC1 5 LYS A 91 ? LYS A 91 . ? 1_555 ? 5 AC1 5 GLU A 96 ? GLU A 96 . ? 1_555 ? 6 AC2 5 ASP A 117 ? ASP A 117 . ? 1_555 ? 7 AC2 5 ASN A 119 ? ASN A 119 . ? 1_555 ? 8 AC2 5 ASP A 121 ? ASP A 121 . ? 1_555 ? 9 AC2 5 TYR A 123 ? TYR A 123 . ? 1_555 ? 10 AC2 5 GLU A 128 ? GLU A 128 . ? 1_555 ? # _atom_sites.entry_id 2M7N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 PHE 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 ILE 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 VAL 11 11 ? ? ? A . n A 1 12 ASN 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 ASP 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 VAL 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 TYR 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 VAL 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 PHE 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 LYS 28 28 ? ? ? A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 ARG 30 30 ? ? ? A . n A 1 31 ALA 31 31 ? ? ? A . n A 1 32 ILE 32 32 ? ? ? A . n A 1 33 LYS 33 33 ? ? ? A . n A 1 34 ASN 34 34 ? ? ? A . n A 1 35 GLU 35 35 ? ? ? A . n A 1 36 GLN 36 36 ? ? ? A . n A 1 37 LEU 37 37 ? ? ? A . n A 1 38 LEU 38 38 ? ? ? A . n A 1 39 GLN 39 39 ? ? ? A . n A 1 40 LEU 40 40 ? ? ? A . n A 1 41 ILE 41 41 ? ? ? A . n A 1 42 PHE 42 42 ? ? ? A . n A 1 43 LYS 43 43 ? ? ? A . n A 1 44 SER 44 44 ? ? ? A . n A 1 45 ILE 45 45 ? ? ? A . n A 1 46 ASP 46 46 ? ? ? A . n A 1 47 ALA 47 47 ? ? ? A . n A 1 48 ASP 48 48 ? ? ? A . n A 1 49 GLY 49 49 ? ? ? A . n A 1 50 ASN 50 50 ? ? ? A . n A 1 51 GLY 51 51 ? ? ? A . n A 1 52 GLU 52 52 ? ? ? A . n A 1 53 ILE 53 53 ? ? ? A . n A 1 54 ASP 54 54 ? ? ? A . n A 1 55 GLN 55 55 ? ? ? A . n A 1 56 ASN 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 PHE 58 58 ? ? ? A . n A 1 59 ALA 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 PHE 61 61 ? ? ? A . n A 1 62 TYR 62 62 ? ? ? A . n A 1 63 GLY 63 63 ? ? ? A . n A 1 64 SER 64 64 ? ? ? A . n A 1 65 ILE 65 65 ? ? ? A . n A 1 66 GLN 66 66 ? ? ? A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 350 CA CA A . C 2 CA 1 202 400 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 30.5 ? 2 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 103.7 ? 3 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 74.4 ? 4 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 148.3 ? 5 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 118.4 ? 6 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 44.6 ? 7 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 72.9 ? 8 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 62.8 ? 9 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 57.0 ? 10 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 85.8 ? 11 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 115.6 ? 12 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 106.3 ? 13 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 59.0 ? 14 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 54.5 ? 15 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 44.6 ? 16 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LYS 91 ? A LYS 91 ? 1_555 73.4 ? 17 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LYS 91 ? A LYS 91 ? 1_555 91.2 ? 18 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LYS 91 ? A LYS 91 ? 1_555 109.5 ? 19 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LYS 91 ? A LYS 91 ? 1_555 113.4 ? 20 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LYS 91 ? A LYS 91 ? 1_555 55.3 ? 21 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LYS 91 ? A LYS 91 ? 1_555 60.6 ? 22 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 54.9 ? 23 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 74.5 ? 24 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 138.3 ? 25 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 144.4 ? 26 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 127.1 ? 27 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 158.8 ? 28 O ? A LYS 91 ? A LYS 91 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 98.4 ? 29 OD2 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 98.6 ? 30 OD1 ? A ASP 85 ? A ASP 85 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 105.8 ? 31 OD1 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 119.4 ? 32 OD2 ? A ASP 87 ? A ASP 87 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 98.5 ? 33 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 168.4 ? 34 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 145.4 ? 35 O ? A LYS 91 ? A LYS 91 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 130.8 ? 36 OE2 ? A GLU 96 ? A GLU 96 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 96 ? A GLU 96 ? 1_555 46.6 ? 37 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 45.8 ? 38 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 106.3 ? 39 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 60.8 ? 40 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 120.9 ? 41 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 99.7 ? 42 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 72.0 ? 43 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 64.1 ? 44 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 59.1 ? 45 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 86.3 ? 46 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 56.8 ? 47 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A TYR 123 ? A TYR 123 ? 1_555 80.5 ? 48 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A TYR 123 ? A TYR 123 ? 1_555 108.6 ? 49 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A TYR 123 ? A TYR 123 ? 1_555 135.0 ? 50 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A TYR 123 ? A TYR 123 ? 1_555 67.0 ? 51 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A TYR 123 ? A TYR 123 ? 1_555 56.0 ? 52 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 107.1 ? 53 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 145.5 ? 54 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 134.3 ? 55 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 114.3 ? 56 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 136.7 ? 57 O ? A TYR 123 ? A TYR 123 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 81.0 ? 58 OD2 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 140.0 ? 59 OD1 ? A ASP 117 ? A ASP 117 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 169.6 ? 60 OD1 ? A ASN 119 ? A ASN 119 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 113.5 ? 61 OD2 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 70.0 ? 62 OD1 ? A ASP 121 ? A ASP 121 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 113.4 ? 63 O ? A TYR 123 ? A TYR 123 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 68.7 ? 64 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 44.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-19 2 'Structure model' 1 1 2013-07-03 3 'Structure model' 1 2 2013-08-28 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.value' 19 4 'Structure model' '_struct_conn.pdbx_dist_value' 20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_ref_seq_dif.details' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id '(Y81F)-EhCaBP1-1' 0.8 ? mM '[U-99% 15N]' 1 '(Y81F)-EhCaBP1-2' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 2 '(Y81F)-EhCaBP1-3' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 70 ? ? -61.29 -170.26 2 1 ASP A 72 ? ? -35.52 149.04 3 1 ASP A 85 ? ? -106.54 74.09 4 1 PHE A 132 ? ? -108.38 69.91 5 2 LEU A 70 ? ? -60.88 -170.46 6 2 ASP A 72 ? ? -35.77 149.50 7 2 PHE A 132 ? ? -111.33 70.36 8 3 LEU A 70 ? ? -60.91 -170.29 9 3 ASP A 72 ? ? -35.54 149.16 10 3 ASP A 85 ? ? -105.78 75.07 11 3 PHE A 132 ? ? -108.58 69.96 12 4 LEU A 70 ? ? -57.44 179.74 13 4 ASP A 72 ? ? -35.55 149.14 14 4 PHE A 132 ? ? -112.18 70.45 15 5 LEU A 70 ? ? -58.87 -176.73 16 5 ASP A 72 ? ? -35.37 149.00 17 5 ASP A 85 ? ? -104.08 74.85 18 5 PHE A 132 ? ? -109.53 69.97 19 6 ASP A 72 ? ? -35.38 149.08 20 6 PHE A 132 ? ? -111.96 70.28 21 7 ASP A 72 ? ? -35.00 148.13 22 7 ASP A 85 ? ? -102.18 76.15 23 7 PHE A 132 ? ? -110.85 69.77 24 8 LEU A 70 ? ? -60.28 -171.11 25 8 ASP A 72 ? ? -34.76 147.66 26 8 ASP A 85 ? ? -103.21 73.56 27 8 PHE A 132 ? ? -109.50 70.08 28 9 ASP A 72 ? ? -35.23 148.82 29 9 PHE A 132 ? ? -112.09 70.20 30 10 LEU A 70 ? ? -59.71 177.93 31 10 ASP A 72 ? ? -34.90 147.83 32 10 ASP A 85 ? ? -105.75 76.83 33 10 PHE A 132 ? ? -109.27 70.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A PHE 6 ? A PHE 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A ILE 9 ? A ILE 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A VAL 11 ? A VAL 11 12 1 Y 1 A ASN 12 ? A ASN 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A ASP 14 ? A ASP 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A VAL 17 ? A VAL 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A TYR 19 ? A TYR 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A GLU 21 ? A GLU 21 22 1 Y 1 A VAL 22 ? A VAL 22 23 1 Y 1 A LYS 23 ? A LYS 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A PHE 25 ? A PHE 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A LYS 28 ? A LYS 28 29 1 Y 1 A LYS 29 ? A LYS 29 30 1 Y 1 A ARG 30 ? A ARG 30 31 1 Y 1 A ALA 31 ? A ALA 31 32 1 Y 1 A ILE 32 ? A ILE 32 33 1 Y 1 A LYS 33 ? A LYS 33 34 1 Y 1 A ASN 34 ? A ASN 34 35 1 Y 1 A GLU 35 ? A GLU 35 36 1 Y 1 A GLN 36 ? A GLN 36 37 1 Y 1 A LEU 37 ? A LEU 37 38 1 Y 1 A LEU 38 ? A LEU 38 39 1 Y 1 A GLN 39 ? A GLN 39 40 1 Y 1 A LEU 40 ? A LEU 40 41 1 Y 1 A ILE 41 ? A ILE 41 42 1 Y 1 A PHE 42 ? A PHE 42 43 1 Y 1 A LYS 43 ? A LYS 43 44 1 Y 1 A SER 44 ? A SER 44 45 1 Y 1 A ILE 45 ? A ILE 45 46 1 Y 1 A ASP 46 ? A ASP 46 47 1 Y 1 A ALA 47 ? A ALA 47 48 1 Y 1 A ASP 48 ? A ASP 48 49 1 Y 1 A GLY 49 ? A GLY 49 50 1 Y 1 A ASN 50 ? A ASN 50 51 1 Y 1 A GLY 51 ? A GLY 51 52 1 Y 1 A GLU 52 ? A GLU 52 53 1 Y 1 A ILE 53 ? A ILE 53 54 1 Y 1 A ASP 54 ? A ASP 54 55 1 Y 1 A GLN 55 ? A GLN 55 56 1 Y 1 A ASN 56 ? A ASN 56 57 1 Y 1 A GLU 57 ? A GLU 57 58 1 Y 1 A PHE 58 ? A PHE 58 59 1 Y 1 A ALA 59 ? A ALA 59 60 1 Y 1 A LYS 60 ? A LYS 60 61 1 Y 1 A PHE 61 ? A PHE 61 62 1 Y 1 A TYR 62 ? A TYR 62 63 1 Y 1 A GLY 63 ? A GLY 63 64 1 Y 1 A SER 64 ? A SER 64 65 1 Y 1 A ILE 65 ? A ILE 65 66 1 Y 1 A GLN 66 ? A GLN 66 67 2 Y 1 A MET 1 ? A MET 1 68 2 Y 1 A ALA 2 ? A ALA 2 69 2 Y 1 A GLU 3 ? A GLU 3 70 2 Y 1 A ALA 4 ? A ALA 4 71 2 Y 1 A LEU 5 ? A LEU 5 72 2 Y 1 A PHE 6 ? A PHE 6 73 2 Y 1 A LYS 7 ? A LYS 7 74 2 Y 1 A GLU 8 ? A GLU 8 75 2 Y 1 A ILE 9 ? A ILE 9 76 2 Y 1 A ASP 10 ? A ASP 10 77 2 Y 1 A VAL 11 ? A VAL 11 78 2 Y 1 A ASN 12 ? A ASN 12 79 2 Y 1 A GLY 13 ? A GLY 13 80 2 Y 1 A ASP 14 ? A ASP 14 81 2 Y 1 A GLY 15 ? A GLY 15 82 2 Y 1 A ALA 16 ? A ALA 16 83 2 Y 1 A VAL 17 ? A VAL 17 84 2 Y 1 A SER 18 ? A SER 18 85 2 Y 1 A TYR 19 ? A TYR 19 86 2 Y 1 A GLU 20 ? A GLU 20 87 2 Y 1 A GLU 21 ? A GLU 21 88 2 Y 1 A VAL 22 ? A VAL 22 89 2 Y 1 A LYS 23 ? A LYS 23 90 2 Y 1 A ALA 24 ? A ALA 24 91 2 Y 1 A PHE 25 ? A PHE 25 92 2 Y 1 A VAL 26 ? A VAL 26 93 2 Y 1 A SER 27 ? A SER 27 94 2 Y 1 A LYS 28 ? A LYS 28 95 2 Y 1 A LYS 29 ? A LYS 29 96 2 Y 1 A ARG 30 ? A ARG 30 97 2 Y 1 A ALA 31 ? A ALA 31 98 2 Y 1 A ILE 32 ? A ILE 32 99 2 Y 1 A LYS 33 ? A LYS 33 100 2 Y 1 A ASN 34 ? A ASN 34 101 2 Y 1 A GLU 35 ? A GLU 35 102 2 Y 1 A GLN 36 ? A GLN 36 103 2 Y 1 A LEU 37 ? A LEU 37 104 2 Y 1 A LEU 38 ? A LEU 38 105 2 Y 1 A GLN 39 ? A GLN 39 106 2 Y 1 A LEU 40 ? A LEU 40 107 2 Y 1 A ILE 41 ? A ILE 41 108 2 Y 1 A PHE 42 ? A PHE 42 109 2 Y 1 A LYS 43 ? A LYS 43 110 2 Y 1 A SER 44 ? A SER 44 111 2 Y 1 A ILE 45 ? A ILE 45 112 2 Y 1 A ASP 46 ? A ASP 46 113 2 Y 1 A ALA 47 ? A ALA 47 114 2 Y 1 A ASP 48 ? A ASP 48 115 2 Y 1 A GLY 49 ? A GLY 49 116 2 Y 1 A ASN 50 ? A ASN 50 117 2 Y 1 A GLY 51 ? A GLY 51 118 2 Y 1 A GLU 52 ? A GLU 52 119 2 Y 1 A ILE 53 ? A ILE 53 120 2 Y 1 A ASP 54 ? A ASP 54 121 2 Y 1 A GLN 55 ? A GLN 55 122 2 Y 1 A ASN 56 ? A ASN 56 123 2 Y 1 A GLU 57 ? A GLU 57 124 2 Y 1 A PHE 58 ? A PHE 58 125 2 Y 1 A ALA 59 ? A ALA 59 126 2 Y 1 A LYS 60 ? A LYS 60 127 2 Y 1 A PHE 61 ? A PHE 61 128 2 Y 1 A TYR 62 ? A TYR 62 129 2 Y 1 A GLY 63 ? A GLY 63 130 2 Y 1 A SER 64 ? A SER 64 131 2 Y 1 A ILE 65 ? A ILE 65 132 2 Y 1 A GLN 66 ? A GLN 66 133 3 Y 1 A MET 1 ? A MET 1 134 3 Y 1 A ALA 2 ? A ALA 2 135 3 Y 1 A GLU 3 ? A GLU 3 136 3 Y 1 A ALA 4 ? A ALA 4 137 3 Y 1 A LEU 5 ? A LEU 5 138 3 Y 1 A PHE 6 ? A PHE 6 139 3 Y 1 A LYS 7 ? A LYS 7 140 3 Y 1 A GLU 8 ? A GLU 8 141 3 Y 1 A ILE 9 ? A ILE 9 142 3 Y 1 A ASP 10 ? A ASP 10 143 3 Y 1 A VAL 11 ? A VAL 11 144 3 Y 1 A ASN 12 ? A ASN 12 145 3 Y 1 A GLY 13 ? A GLY 13 146 3 Y 1 A ASP 14 ? A ASP 14 147 3 Y 1 A GLY 15 ? A GLY 15 148 3 Y 1 A ALA 16 ? A ALA 16 149 3 Y 1 A VAL 17 ? A VAL 17 150 3 Y 1 A SER 18 ? A SER 18 151 3 Y 1 A TYR 19 ? A TYR 19 152 3 Y 1 A GLU 20 ? A GLU 20 153 3 Y 1 A GLU 21 ? A GLU 21 154 3 Y 1 A VAL 22 ? A VAL 22 155 3 Y 1 A LYS 23 ? A LYS 23 156 3 Y 1 A ALA 24 ? A ALA 24 157 3 Y 1 A PHE 25 ? A PHE 25 158 3 Y 1 A VAL 26 ? A VAL 26 159 3 Y 1 A SER 27 ? A SER 27 160 3 Y 1 A LYS 28 ? A LYS 28 161 3 Y 1 A LYS 29 ? A LYS 29 162 3 Y 1 A ARG 30 ? A ARG 30 163 3 Y 1 A ALA 31 ? A ALA 31 164 3 Y 1 A ILE 32 ? A ILE 32 165 3 Y 1 A LYS 33 ? A LYS 33 166 3 Y 1 A ASN 34 ? A ASN 34 167 3 Y 1 A GLU 35 ? A GLU 35 168 3 Y 1 A GLN 36 ? A GLN 36 169 3 Y 1 A LEU 37 ? A LEU 37 170 3 Y 1 A LEU 38 ? A LEU 38 171 3 Y 1 A GLN 39 ? A GLN 39 172 3 Y 1 A LEU 40 ? A LEU 40 173 3 Y 1 A ILE 41 ? A ILE 41 174 3 Y 1 A PHE 42 ? A PHE 42 175 3 Y 1 A LYS 43 ? A LYS 43 176 3 Y 1 A SER 44 ? A SER 44 177 3 Y 1 A ILE 45 ? A ILE 45 178 3 Y 1 A ASP 46 ? A ASP 46 179 3 Y 1 A ALA 47 ? A ALA 47 180 3 Y 1 A ASP 48 ? A ASP 48 181 3 Y 1 A GLY 49 ? A GLY 49 182 3 Y 1 A ASN 50 ? A ASN 50 183 3 Y 1 A GLY 51 ? A GLY 51 184 3 Y 1 A GLU 52 ? A GLU 52 185 3 Y 1 A ILE 53 ? A ILE 53 186 3 Y 1 A ASP 54 ? A ASP 54 187 3 Y 1 A GLN 55 ? A GLN 55 188 3 Y 1 A ASN 56 ? A ASN 56 189 3 Y 1 A GLU 57 ? A GLU 57 190 3 Y 1 A PHE 58 ? A PHE 58 191 3 Y 1 A ALA 59 ? A ALA 59 192 3 Y 1 A LYS 60 ? A LYS 60 193 3 Y 1 A PHE 61 ? A PHE 61 194 3 Y 1 A TYR 62 ? A TYR 62 195 3 Y 1 A GLY 63 ? A GLY 63 196 3 Y 1 A SER 64 ? A SER 64 197 3 Y 1 A ILE 65 ? A ILE 65 198 3 Y 1 A GLN 66 ? A GLN 66 199 4 Y 1 A MET 1 ? A MET 1 200 4 Y 1 A ALA 2 ? A ALA 2 201 4 Y 1 A GLU 3 ? A GLU 3 202 4 Y 1 A ALA 4 ? A ALA 4 203 4 Y 1 A LEU 5 ? A LEU 5 204 4 Y 1 A PHE 6 ? A PHE 6 205 4 Y 1 A LYS 7 ? A LYS 7 206 4 Y 1 A GLU 8 ? A GLU 8 207 4 Y 1 A ILE 9 ? A ILE 9 208 4 Y 1 A ASP 10 ? A ASP 10 209 4 Y 1 A VAL 11 ? A VAL 11 210 4 Y 1 A ASN 12 ? A ASN 12 211 4 Y 1 A GLY 13 ? A GLY 13 212 4 Y 1 A ASP 14 ? A ASP 14 213 4 Y 1 A GLY 15 ? A GLY 15 214 4 Y 1 A ALA 16 ? A ALA 16 215 4 Y 1 A VAL 17 ? A VAL 17 216 4 Y 1 A SER 18 ? A SER 18 217 4 Y 1 A TYR 19 ? A TYR 19 218 4 Y 1 A GLU 20 ? A GLU 20 219 4 Y 1 A GLU 21 ? A GLU 21 220 4 Y 1 A VAL 22 ? A VAL 22 221 4 Y 1 A LYS 23 ? A LYS 23 222 4 Y 1 A ALA 24 ? A ALA 24 223 4 Y 1 A PHE 25 ? A PHE 25 224 4 Y 1 A VAL 26 ? A VAL 26 225 4 Y 1 A SER 27 ? A SER 27 226 4 Y 1 A LYS 28 ? A LYS 28 227 4 Y 1 A LYS 29 ? A LYS 29 228 4 Y 1 A ARG 30 ? A ARG 30 229 4 Y 1 A ALA 31 ? A ALA 31 230 4 Y 1 A ILE 32 ? A ILE 32 231 4 Y 1 A LYS 33 ? A LYS 33 232 4 Y 1 A ASN 34 ? A ASN 34 233 4 Y 1 A GLU 35 ? A GLU 35 234 4 Y 1 A GLN 36 ? A GLN 36 235 4 Y 1 A LEU 37 ? A LEU 37 236 4 Y 1 A LEU 38 ? A LEU 38 237 4 Y 1 A GLN 39 ? A GLN 39 238 4 Y 1 A LEU 40 ? A LEU 40 239 4 Y 1 A ILE 41 ? A ILE 41 240 4 Y 1 A PHE 42 ? A PHE 42 241 4 Y 1 A LYS 43 ? A LYS 43 242 4 Y 1 A SER 44 ? A SER 44 243 4 Y 1 A ILE 45 ? A ILE 45 244 4 Y 1 A ASP 46 ? A ASP 46 245 4 Y 1 A ALA 47 ? A ALA 47 246 4 Y 1 A ASP 48 ? A ASP 48 247 4 Y 1 A GLY 49 ? A GLY 49 248 4 Y 1 A ASN 50 ? A ASN 50 249 4 Y 1 A GLY 51 ? A GLY 51 250 4 Y 1 A GLU 52 ? A GLU 52 251 4 Y 1 A ILE 53 ? A ILE 53 252 4 Y 1 A ASP 54 ? A ASP 54 253 4 Y 1 A GLN 55 ? A GLN 55 254 4 Y 1 A ASN 56 ? A ASN 56 255 4 Y 1 A GLU 57 ? A GLU 57 256 4 Y 1 A PHE 58 ? A PHE 58 257 4 Y 1 A ALA 59 ? A ALA 59 258 4 Y 1 A LYS 60 ? A LYS 60 259 4 Y 1 A PHE 61 ? A PHE 61 260 4 Y 1 A TYR 62 ? A TYR 62 261 4 Y 1 A GLY 63 ? A GLY 63 262 4 Y 1 A SER 64 ? A SER 64 263 4 Y 1 A ILE 65 ? A ILE 65 264 4 Y 1 A GLN 66 ? A GLN 66 265 5 Y 1 A MET 1 ? A MET 1 266 5 Y 1 A ALA 2 ? A ALA 2 267 5 Y 1 A GLU 3 ? A GLU 3 268 5 Y 1 A ALA 4 ? A ALA 4 269 5 Y 1 A LEU 5 ? A LEU 5 270 5 Y 1 A PHE 6 ? A PHE 6 271 5 Y 1 A LYS 7 ? A LYS 7 272 5 Y 1 A GLU 8 ? A GLU 8 273 5 Y 1 A ILE 9 ? A ILE 9 274 5 Y 1 A ASP 10 ? A ASP 10 275 5 Y 1 A VAL 11 ? A VAL 11 276 5 Y 1 A ASN 12 ? A ASN 12 277 5 Y 1 A GLY 13 ? A GLY 13 278 5 Y 1 A ASP 14 ? A ASP 14 279 5 Y 1 A GLY 15 ? A GLY 15 280 5 Y 1 A ALA 16 ? A ALA 16 281 5 Y 1 A VAL 17 ? A VAL 17 282 5 Y 1 A SER 18 ? A SER 18 283 5 Y 1 A TYR 19 ? A TYR 19 284 5 Y 1 A GLU 20 ? A GLU 20 285 5 Y 1 A GLU 21 ? A GLU 21 286 5 Y 1 A VAL 22 ? A VAL 22 287 5 Y 1 A LYS 23 ? A LYS 23 288 5 Y 1 A ALA 24 ? A ALA 24 289 5 Y 1 A PHE 25 ? A PHE 25 290 5 Y 1 A VAL 26 ? A VAL 26 291 5 Y 1 A SER 27 ? A SER 27 292 5 Y 1 A LYS 28 ? A LYS 28 293 5 Y 1 A LYS 29 ? A LYS 29 294 5 Y 1 A ARG 30 ? A ARG 30 295 5 Y 1 A ALA 31 ? A ALA 31 296 5 Y 1 A ILE 32 ? A ILE 32 297 5 Y 1 A LYS 33 ? A LYS 33 298 5 Y 1 A ASN 34 ? A ASN 34 299 5 Y 1 A GLU 35 ? A GLU 35 300 5 Y 1 A GLN 36 ? A GLN 36 301 5 Y 1 A LEU 37 ? A LEU 37 302 5 Y 1 A LEU 38 ? A LEU 38 303 5 Y 1 A GLN 39 ? A GLN 39 304 5 Y 1 A LEU 40 ? A LEU 40 305 5 Y 1 A ILE 41 ? A ILE 41 306 5 Y 1 A PHE 42 ? A PHE 42 307 5 Y 1 A LYS 43 ? A LYS 43 308 5 Y 1 A SER 44 ? A SER 44 309 5 Y 1 A ILE 45 ? A ILE 45 310 5 Y 1 A ASP 46 ? A ASP 46 311 5 Y 1 A ALA 47 ? A ALA 47 312 5 Y 1 A ASP 48 ? A ASP 48 313 5 Y 1 A GLY 49 ? A GLY 49 314 5 Y 1 A ASN 50 ? A ASN 50 315 5 Y 1 A GLY 51 ? A GLY 51 316 5 Y 1 A GLU 52 ? A GLU 52 317 5 Y 1 A ILE 53 ? A ILE 53 318 5 Y 1 A ASP 54 ? A ASP 54 319 5 Y 1 A GLN 55 ? A GLN 55 320 5 Y 1 A ASN 56 ? A ASN 56 321 5 Y 1 A GLU 57 ? A GLU 57 322 5 Y 1 A PHE 58 ? A PHE 58 323 5 Y 1 A ALA 59 ? A ALA 59 324 5 Y 1 A LYS 60 ? A LYS 60 325 5 Y 1 A PHE 61 ? A PHE 61 326 5 Y 1 A TYR 62 ? A TYR 62 327 5 Y 1 A GLY 63 ? A GLY 63 328 5 Y 1 A SER 64 ? A SER 64 329 5 Y 1 A ILE 65 ? A ILE 65 330 5 Y 1 A GLN 66 ? A GLN 66 331 6 Y 1 A MET 1 ? A MET 1 332 6 Y 1 A ALA 2 ? A ALA 2 333 6 Y 1 A GLU 3 ? A GLU 3 334 6 Y 1 A ALA 4 ? A ALA 4 335 6 Y 1 A LEU 5 ? A LEU 5 336 6 Y 1 A PHE 6 ? A PHE 6 337 6 Y 1 A LYS 7 ? A LYS 7 338 6 Y 1 A GLU 8 ? A GLU 8 339 6 Y 1 A ILE 9 ? A ILE 9 340 6 Y 1 A ASP 10 ? A ASP 10 341 6 Y 1 A VAL 11 ? A VAL 11 342 6 Y 1 A ASN 12 ? A ASN 12 343 6 Y 1 A GLY 13 ? A GLY 13 344 6 Y 1 A ASP 14 ? A ASP 14 345 6 Y 1 A GLY 15 ? A GLY 15 346 6 Y 1 A ALA 16 ? A ALA 16 347 6 Y 1 A VAL 17 ? A VAL 17 348 6 Y 1 A SER 18 ? A SER 18 349 6 Y 1 A TYR 19 ? A TYR 19 350 6 Y 1 A GLU 20 ? A GLU 20 351 6 Y 1 A GLU 21 ? A GLU 21 352 6 Y 1 A VAL 22 ? A VAL 22 353 6 Y 1 A LYS 23 ? A LYS 23 354 6 Y 1 A ALA 24 ? A ALA 24 355 6 Y 1 A PHE 25 ? A PHE 25 356 6 Y 1 A VAL 26 ? A VAL 26 357 6 Y 1 A SER 27 ? A SER 27 358 6 Y 1 A LYS 28 ? A LYS 28 359 6 Y 1 A LYS 29 ? A LYS 29 360 6 Y 1 A ARG 30 ? A ARG 30 361 6 Y 1 A ALA 31 ? A ALA 31 362 6 Y 1 A ILE 32 ? A ILE 32 363 6 Y 1 A LYS 33 ? A LYS 33 364 6 Y 1 A ASN 34 ? A ASN 34 365 6 Y 1 A GLU 35 ? A GLU 35 366 6 Y 1 A GLN 36 ? A GLN 36 367 6 Y 1 A LEU 37 ? A LEU 37 368 6 Y 1 A LEU 38 ? A LEU 38 369 6 Y 1 A GLN 39 ? A GLN 39 370 6 Y 1 A LEU 40 ? A LEU 40 371 6 Y 1 A ILE 41 ? A ILE 41 372 6 Y 1 A PHE 42 ? A PHE 42 373 6 Y 1 A LYS 43 ? A LYS 43 374 6 Y 1 A SER 44 ? A SER 44 375 6 Y 1 A ILE 45 ? A ILE 45 376 6 Y 1 A ASP 46 ? A ASP 46 377 6 Y 1 A ALA 47 ? A ALA 47 378 6 Y 1 A ASP 48 ? A ASP 48 379 6 Y 1 A GLY 49 ? A GLY 49 380 6 Y 1 A ASN 50 ? A ASN 50 381 6 Y 1 A GLY 51 ? A GLY 51 382 6 Y 1 A GLU 52 ? A GLU 52 383 6 Y 1 A ILE 53 ? A ILE 53 384 6 Y 1 A ASP 54 ? A ASP 54 385 6 Y 1 A GLN 55 ? A GLN 55 386 6 Y 1 A ASN 56 ? A ASN 56 387 6 Y 1 A GLU 57 ? A GLU 57 388 6 Y 1 A PHE 58 ? A PHE 58 389 6 Y 1 A ALA 59 ? A ALA 59 390 6 Y 1 A LYS 60 ? A LYS 60 391 6 Y 1 A PHE 61 ? A PHE 61 392 6 Y 1 A TYR 62 ? A TYR 62 393 6 Y 1 A GLY 63 ? A GLY 63 394 6 Y 1 A SER 64 ? A SER 64 395 6 Y 1 A ILE 65 ? A ILE 65 396 6 Y 1 A GLN 66 ? A GLN 66 397 7 Y 1 A MET 1 ? A MET 1 398 7 Y 1 A ALA 2 ? A ALA 2 399 7 Y 1 A GLU 3 ? A GLU 3 400 7 Y 1 A ALA 4 ? A ALA 4 401 7 Y 1 A LEU 5 ? A LEU 5 402 7 Y 1 A PHE 6 ? A PHE 6 403 7 Y 1 A LYS 7 ? A LYS 7 404 7 Y 1 A GLU 8 ? A GLU 8 405 7 Y 1 A ILE 9 ? A ILE 9 406 7 Y 1 A ASP 10 ? A ASP 10 407 7 Y 1 A VAL 11 ? A VAL 11 408 7 Y 1 A ASN 12 ? A ASN 12 409 7 Y 1 A GLY 13 ? A GLY 13 410 7 Y 1 A ASP 14 ? A ASP 14 411 7 Y 1 A GLY 15 ? A GLY 15 412 7 Y 1 A ALA 16 ? A ALA 16 413 7 Y 1 A VAL 17 ? A VAL 17 414 7 Y 1 A SER 18 ? A SER 18 415 7 Y 1 A TYR 19 ? A TYR 19 416 7 Y 1 A GLU 20 ? A GLU 20 417 7 Y 1 A GLU 21 ? A GLU 21 418 7 Y 1 A VAL 22 ? A VAL 22 419 7 Y 1 A LYS 23 ? A LYS 23 420 7 Y 1 A ALA 24 ? A ALA 24 421 7 Y 1 A PHE 25 ? A PHE 25 422 7 Y 1 A VAL 26 ? A VAL 26 423 7 Y 1 A SER 27 ? A SER 27 424 7 Y 1 A LYS 28 ? A LYS 28 425 7 Y 1 A LYS 29 ? A LYS 29 426 7 Y 1 A ARG 30 ? A ARG 30 427 7 Y 1 A ALA 31 ? A ALA 31 428 7 Y 1 A ILE 32 ? A ILE 32 429 7 Y 1 A LYS 33 ? A LYS 33 430 7 Y 1 A ASN 34 ? A ASN 34 431 7 Y 1 A GLU 35 ? A GLU 35 432 7 Y 1 A GLN 36 ? A GLN 36 433 7 Y 1 A LEU 37 ? A LEU 37 434 7 Y 1 A LEU 38 ? A LEU 38 435 7 Y 1 A GLN 39 ? A GLN 39 436 7 Y 1 A LEU 40 ? A LEU 40 437 7 Y 1 A ILE 41 ? A ILE 41 438 7 Y 1 A PHE 42 ? A PHE 42 439 7 Y 1 A LYS 43 ? A LYS 43 440 7 Y 1 A SER 44 ? A SER 44 441 7 Y 1 A ILE 45 ? A ILE 45 442 7 Y 1 A ASP 46 ? A ASP 46 443 7 Y 1 A ALA 47 ? A ALA 47 444 7 Y 1 A ASP 48 ? A ASP 48 445 7 Y 1 A GLY 49 ? A GLY 49 446 7 Y 1 A ASN 50 ? A ASN 50 447 7 Y 1 A GLY 51 ? A GLY 51 448 7 Y 1 A GLU 52 ? A GLU 52 449 7 Y 1 A ILE 53 ? A ILE 53 450 7 Y 1 A ASP 54 ? A ASP 54 451 7 Y 1 A GLN 55 ? A GLN 55 452 7 Y 1 A ASN 56 ? A ASN 56 453 7 Y 1 A GLU 57 ? A GLU 57 454 7 Y 1 A PHE 58 ? A PHE 58 455 7 Y 1 A ALA 59 ? A ALA 59 456 7 Y 1 A LYS 60 ? A LYS 60 457 7 Y 1 A PHE 61 ? A PHE 61 458 7 Y 1 A TYR 62 ? A TYR 62 459 7 Y 1 A GLY 63 ? A GLY 63 460 7 Y 1 A SER 64 ? A SER 64 461 7 Y 1 A ILE 65 ? A ILE 65 462 7 Y 1 A GLN 66 ? A GLN 66 463 8 Y 1 A MET 1 ? A MET 1 464 8 Y 1 A ALA 2 ? A ALA 2 465 8 Y 1 A GLU 3 ? A GLU 3 466 8 Y 1 A ALA 4 ? A ALA 4 467 8 Y 1 A LEU 5 ? A LEU 5 468 8 Y 1 A PHE 6 ? A PHE 6 469 8 Y 1 A LYS 7 ? A LYS 7 470 8 Y 1 A GLU 8 ? A GLU 8 471 8 Y 1 A ILE 9 ? A ILE 9 472 8 Y 1 A ASP 10 ? A ASP 10 473 8 Y 1 A VAL 11 ? A VAL 11 474 8 Y 1 A ASN 12 ? A ASN 12 475 8 Y 1 A GLY 13 ? A GLY 13 476 8 Y 1 A ASP 14 ? A ASP 14 477 8 Y 1 A GLY 15 ? A GLY 15 478 8 Y 1 A ALA 16 ? A ALA 16 479 8 Y 1 A VAL 17 ? A VAL 17 480 8 Y 1 A SER 18 ? A SER 18 481 8 Y 1 A TYR 19 ? A TYR 19 482 8 Y 1 A GLU 20 ? A GLU 20 483 8 Y 1 A GLU 21 ? A GLU 21 484 8 Y 1 A VAL 22 ? A VAL 22 485 8 Y 1 A LYS 23 ? A LYS 23 486 8 Y 1 A ALA 24 ? A ALA 24 487 8 Y 1 A PHE 25 ? A PHE 25 488 8 Y 1 A VAL 26 ? A VAL 26 489 8 Y 1 A SER 27 ? A SER 27 490 8 Y 1 A LYS 28 ? A LYS 28 491 8 Y 1 A LYS 29 ? A LYS 29 492 8 Y 1 A ARG 30 ? A ARG 30 493 8 Y 1 A ALA 31 ? A ALA 31 494 8 Y 1 A ILE 32 ? A ILE 32 495 8 Y 1 A LYS 33 ? A LYS 33 496 8 Y 1 A ASN 34 ? A ASN 34 497 8 Y 1 A GLU 35 ? A GLU 35 498 8 Y 1 A GLN 36 ? A GLN 36 499 8 Y 1 A LEU 37 ? A LEU 37 500 8 Y 1 A LEU 38 ? A LEU 38 501 8 Y 1 A GLN 39 ? A GLN 39 502 8 Y 1 A LEU 40 ? A LEU 40 503 8 Y 1 A ILE 41 ? A ILE 41 504 8 Y 1 A PHE 42 ? A PHE 42 505 8 Y 1 A LYS 43 ? A LYS 43 506 8 Y 1 A SER 44 ? A SER 44 507 8 Y 1 A ILE 45 ? A ILE 45 508 8 Y 1 A ASP 46 ? A ASP 46 509 8 Y 1 A ALA 47 ? A ALA 47 510 8 Y 1 A ASP 48 ? A ASP 48 511 8 Y 1 A GLY 49 ? A GLY 49 512 8 Y 1 A ASN 50 ? A ASN 50 513 8 Y 1 A GLY 51 ? A GLY 51 514 8 Y 1 A GLU 52 ? A GLU 52 515 8 Y 1 A ILE 53 ? A ILE 53 516 8 Y 1 A ASP 54 ? A ASP 54 517 8 Y 1 A GLN 55 ? A GLN 55 518 8 Y 1 A ASN 56 ? A ASN 56 519 8 Y 1 A GLU 57 ? A GLU 57 520 8 Y 1 A PHE 58 ? A PHE 58 521 8 Y 1 A ALA 59 ? A ALA 59 522 8 Y 1 A LYS 60 ? A LYS 60 523 8 Y 1 A PHE 61 ? A PHE 61 524 8 Y 1 A TYR 62 ? A TYR 62 525 8 Y 1 A GLY 63 ? A GLY 63 526 8 Y 1 A SER 64 ? A SER 64 527 8 Y 1 A ILE 65 ? A ILE 65 528 8 Y 1 A GLN 66 ? A GLN 66 529 9 Y 1 A MET 1 ? A MET 1 530 9 Y 1 A ALA 2 ? A ALA 2 531 9 Y 1 A GLU 3 ? A GLU 3 532 9 Y 1 A ALA 4 ? A ALA 4 533 9 Y 1 A LEU 5 ? A LEU 5 534 9 Y 1 A PHE 6 ? A PHE 6 535 9 Y 1 A LYS 7 ? A LYS 7 536 9 Y 1 A GLU 8 ? A GLU 8 537 9 Y 1 A ILE 9 ? A ILE 9 538 9 Y 1 A ASP 10 ? A ASP 10 539 9 Y 1 A VAL 11 ? A VAL 11 540 9 Y 1 A ASN 12 ? A ASN 12 541 9 Y 1 A GLY 13 ? A GLY 13 542 9 Y 1 A ASP 14 ? A ASP 14 543 9 Y 1 A GLY 15 ? A GLY 15 544 9 Y 1 A ALA 16 ? A ALA 16 545 9 Y 1 A VAL 17 ? A VAL 17 546 9 Y 1 A SER 18 ? A SER 18 547 9 Y 1 A TYR 19 ? A TYR 19 548 9 Y 1 A GLU 20 ? A GLU 20 549 9 Y 1 A GLU 21 ? A GLU 21 550 9 Y 1 A VAL 22 ? A VAL 22 551 9 Y 1 A LYS 23 ? A LYS 23 552 9 Y 1 A ALA 24 ? A ALA 24 553 9 Y 1 A PHE 25 ? A PHE 25 554 9 Y 1 A VAL 26 ? A VAL 26 555 9 Y 1 A SER 27 ? A SER 27 556 9 Y 1 A LYS 28 ? A LYS 28 557 9 Y 1 A LYS 29 ? A LYS 29 558 9 Y 1 A ARG 30 ? A ARG 30 559 9 Y 1 A ALA 31 ? A ALA 31 560 9 Y 1 A ILE 32 ? A ILE 32 561 9 Y 1 A LYS 33 ? A LYS 33 562 9 Y 1 A ASN 34 ? A ASN 34 563 9 Y 1 A GLU 35 ? A GLU 35 564 9 Y 1 A GLN 36 ? A GLN 36 565 9 Y 1 A LEU 37 ? A LEU 37 566 9 Y 1 A LEU 38 ? A LEU 38 567 9 Y 1 A GLN 39 ? A GLN 39 568 9 Y 1 A LEU 40 ? A LEU 40 569 9 Y 1 A ILE 41 ? A ILE 41 570 9 Y 1 A PHE 42 ? A PHE 42 571 9 Y 1 A LYS 43 ? A LYS 43 572 9 Y 1 A SER 44 ? A SER 44 573 9 Y 1 A ILE 45 ? A ILE 45 574 9 Y 1 A ASP 46 ? A ASP 46 575 9 Y 1 A ALA 47 ? A ALA 47 576 9 Y 1 A ASP 48 ? A ASP 48 577 9 Y 1 A GLY 49 ? A GLY 49 578 9 Y 1 A ASN 50 ? A ASN 50 579 9 Y 1 A GLY 51 ? A GLY 51 580 9 Y 1 A GLU 52 ? A GLU 52 581 9 Y 1 A ILE 53 ? A ILE 53 582 9 Y 1 A ASP 54 ? A ASP 54 583 9 Y 1 A GLN 55 ? A GLN 55 584 9 Y 1 A ASN 56 ? A ASN 56 585 9 Y 1 A GLU 57 ? A GLU 57 586 9 Y 1 A PHE 58 ? A PHE 58 587 9 Y 1 A ALA 59 ? A ALA 59 588 9 Y 1 A LYS 60 ? A LYS 60 589 9 Y 1 A PHE 61 ? A PHE 61 590 9 Y 1 A TYR 62 ? A TYR 62 591 9 Y 1 A GLY 63 ? A GLY 63 592 9 Y 1 A SER 64 ? A SER 64 593 9 Y 1 A ILE 65 ? A ILE 65 594 9 Y 1 A GLN 66 ? A GLN 66 595 10 Y 1 A MET 1 ? A MET 1 596 10 Y 1 A ALA 2 ? A ALA 2 597 10 Y 1 A GLU 3 ? A GLU 3 598 10 Y 1 A ALA 4 ? A ALA 4 599 10 Y 1 A LEU 5 ? A LEU 5 600 10 Y 1 A PHE 6 ? A PHE 6 601 10 Y 1 A LYS 7 ? A LYS 7 602 10 Y 1 A GLU 8 ? A GLU 8 603 10 Y 1 A ILE 9 ? A ILE 9 604 10 Y 1 A ASP 10 ? A ASP 10 605 10 Y 1 A VAL 11 ? A VAL 11 606 10 Y 1 A ASN 12 ? A ASN 12 607 10 Y 1 A GLY 13 ? A GLY 13 608 10 Y 1 A ASP 14 ? A ASP 14 609 10 Y 1 A GLY 15 ? A GLY 15 610 10 Y 1 A ALA 16 ? A ALA 16 611 10 Y 1 A VAL 17 ? A VAL 17 612 10 Y 1 A SER 18 ? A SER 18 613 10 Y 1 A TYR 19 ? A TYR 19 614 10 Y 1 A GLU 20 ? A GLU 20 615 10 Y 1 A GLU 21 ? A GLU 21 616 10 Y 1 A VAL 22 ? A VAL 22 617 10 Y 1 A LYS 23 ? A LYS 23 618 10 Y 1 A ALA 24 ? A ALA 24 619 10 Y 1 A PHE 25 ? A PHE 25 620 10 Y 1 A VAL 26 ? A VAL 26 621 10 Y 1 A SER 27 ? A SER 27 622 10 Y 1 A LYS 28 ? A LYS 28 623 10 Y 1 A LYS 29 ? A LYS 29 624 10 Y 1 A ARG 30 ? A ARG 30 625 10 Y 1 A ALA 31 ? A ALA 31 626 10 Y 1 A ILE 32 ? A ILE 32 627 10 Y 1 A LYS 33 ? A LYS 33 628 10 Y 1 A ASN 34 ? A ASN 34 629 10 Y 1 A GLU 35 ? A GLU 35 630 10 Y 1 A GLN 36 ? A GLN 36 631 10 Y 1 A LEU 37 ? A LEU 37 632 10 Y 1 A LEU 38 ? A LEU 38 633 10 Y 1 A GLN 39 ? A GLN 39 634 10 Y 1 A LEU 40 ? A LEU 40 635 10 Y 1 A ILE 41 ? A ILE 41 636 10 Y 1 A PHE 42 ? A PHE 42 637 10 Y 1 A LYS 43 ? A LYS 43 638 10 Y 1 A SER 44 ? A SER 44 639 10 Y 1 A ILE 45 ? A ILE 45 640 10 Y 1 A ASP 46 ? A ASP 46 641 10 Y 1 A ALA 47 ? A ALA 47 642 10 Y 1 A ASP 48 ? A ASP 48 643 10 Y 1 A GLY 49 ? A GLY 49 644 10 Y 1 A ASN 50 ? A ASN 50 645 10 Y 1 A GLY 51 ? A GLY 51 646 10 Y 1 A GLU 52 ? A GLU 52 647 10 Y 1 A ILE 53 ? A ILE 53 648 10 Y 1 A ASP 54 ? A ASP 54 649 10 Y 1 A GLN 55 ? A GLN 55 650 10 Y 1 A ASN 56 ? A ASN 56 651 10 Y 1 A GLU 57 ? A GLU 57 652 10 Y 1 A PHE 58 ? A PHE 58 653 10 Y 1 A ALA 59 ? A ALA 59 654 10 Y 1 A LYS 60 ? A LYS 60 655 10 Y 1 A PHE 61 ? A PHE 61 656 10 Y 1 A TYR 62 ? A TYR 62 657 10 Y 1 A GLY 63 ? A GLY 63 658 10 Y 1 A SER 64 ? A SER 64 659 10 Y 1 A ILE 65 ? A ILE 65 660 10 Y 1 A GLN 66 ? A GLN 66 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #