data_2M7X # _entry.id 2M7X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M7X pdb_00002m7x 10.2210/pdb2m7x/pdb RCSB RCSB103321 ? ? BMRB 19216 ? 10.13018/BMR19216 WWPDB D_1000103321 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-05 2 'Structure model' 1 1 2013-07-24 3 'Structure model' 1 2 2013-09-11 4 'Structure model' 1 3 2016-10-12 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' struct_ref_seq_dif 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_struct_ref_seq_dif.details' 6 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M7X _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-05-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19216 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ullah, A.' 1 'Kemp, G.' 2 'Lee, B.' 3 'Alves, C.' 4 'Young, H.' 5 'Sykes, B.D.' 6 'Fliegel, L.' 7 # _citation.id primary _citation.title 'Structural and Functional Analysis of Transmembrane Segment IV of the Salt Tolerance Protein Sod2.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 24609 _citation.page_last 24624 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23836910 _citation.pdbx_database_id_DOI 10.1074/jbc.M113.483065 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ullah, A.' 1 ? primary 'Kemp, G.' 2 ? primary 'Lee, B.' 3 ? primary 'Alves, C.' 4 ? primary 'Young, H.' 5 ? primary 'Sykes, B.D.' 6 ? primary 'Fliegel, L.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Na(+)/H(+) antiporter' _entity.formula_weight 3992.854 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSKKKLFPQINFLGSLLIAGCITSTDPVLSALIVGKKK _entity_poly.pdbx_seq_one_letter_code_can GSKKKLFPQINFLGSLLIAGCITSTDPVLSALIVGKKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 LYS n 1 5 LYS n 1 6 LEU n 1 7 PHE n 1 8 PRO n 1 9 GLN n 1 10 ILE n 1 11 ASN n 1 12 PHE n 1 13 LEU n 1 14 GLY n 1 15 SER n 1 16 LEU n 1 17 LEU n 1 18 ILE n 1 19 ALA n 1 20 GLY n 1 21 CYS n 1 22 ILE n 1 23 THR n 1 24 SER n 1 25 THR n 1 26 ASP n 1 27 PRO n 1 28 VAL n 1 29 LEU n 1 30 SER n 1 31 ALA n 1 32 LEU n 1 33 ILE n 1 34 VAL n 1 35 GLY n 1 36 LYS n 1 37 LYS n 1 38 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Fission yeast' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sod2, SPAC977.10' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain '972 / ATCC 24843' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 284812 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain XL1-Blue _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pMal-c2x _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Maltose Binding Protein fusion' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 120 ? ? ? A . n A 1 2 SER 2 121 ? ? ? A . n A 1 3 LYS 3 122 ? ? ? A . n A 1 4 LYS 4 123 ? ? ? A . n A 1 5 LYS 5 124 ? ? ? A . n A 1 6 LEU 6 125 125 LEU LEU A . n A 1 7 PHE 7 126 126 PHE PHE A . n A 1 8 PRO 8 127 127 PRO PRO A . n A 1 9 GLN 9 128 128 GLN GLN A . n A 1 10 ILE 10 129 129 ILE ILE A . n A 1 11 ASN 11 130 130 ASN ASN A . n A 1 12 PHE 12 131 131 PHE PHE A . n A 1 13 LEU 13 132 132 LEU LEU A . n A 1 14 GLY 14 133 133 GLY GLY A . n A 1 15 SER 15 134 134 SER SER A . n A 1 16 LEU 16 135 135 LEU LEU A . n A 1 17 LEU 17 136 136 LEU LEU A . n A 1 18 ILE 18 137 137 ILE ILE A . n A 1 19 ALA 19 138 138 ALA ALA A . n A 1 20 GLY 20 139 139 GLY GLY A . n A 1 21 CYS 21 140 140 CYS CYS A . n A 1 22 ILE 22 141 141 ILE ILE A . n A 1 23 THR 23 142 142 THR THR A . n A 1 24 SER 24 143 143 SER SER A . n A 1 25 THR 25 144 144 THR THR A . n A 1 26 ASP 26 145 145 ASP ASP A . n A 1 27 PRO 27 146 146 PRO PRO A . n A 1 28 VAL 28 147 147 VAL VAL A . n A 1 29 LEU 29 148 148 LEU LEU A . n A 1 30 SER 30 149 149 SER SER A . n A 1 31 ALA 31 150 150 ALA ALA A . n A 1 32 LEU 32 151 151 LEU LEU A . n A 1 33 ILE 33 152 152 ILE ILE A . n A 1 34 VAL 34 153 153 VAL VAL A . n A 1 35 GLY 35 154 154 GLY GLY A . n A 1 36 LYS 36 155 ? ? ? A . n A 1 37 LYS 37 156 ? ? ? A . n A 1 38 LYS 38 157 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR solution model of transmembrane segment IV Sod2 in organic solvent' _exptl.entry_id 2M7X _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M7X _struct.title 'Structural and Functional Analysis of Transmembrane Segment IV of the Salt Tolerance Protein Sod2' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M7X _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'sod2, transmembrane, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NAH_SCHPO _struct_ref.pdbx_db_accession P36606 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LFPQINFLGSLLIAGCITSTDPVLSALIVG _struct_ref.pdbx_align_begin 125 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M7X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36606 _struct_ref_seq.db_align_beg 125 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 125 _struct_ref_seq.pdbx_auth_seq_align_end 154 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M7X GLY A 1 ? UNP P36606 ? ? 'expression tag' 120 1 1 2M7X SER A 2 ? UNP P36606 ? ? 'expression tag' 121 2 1 2M7X LYS A 3 ? UNP P36606 ? ? 'expression tag' 122 3 1 2M7X LYS A 4 ? UNP P36606 ? ? 'expression tag' 123 4 1 2M7X LYS A 5 ? UNP P36606 ? ? 'expression tag' 124 5 1 2M7X LYS A 36 ? UNP P36606 ? ? 'expression tag' 155 6 1 2M7X LYS A 37 ? UNP P36606 ? ? 'expression tag' 156 7 1 2M7X LYS A 38 ? UNP P36606 ? ? 'expression tag' 157 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 10 ? SER A 24 ? ILE A 129 SER A 143 1 ? 15 HELX_P HELX_P2 2 PRO A 27 ? VAL A 34 ? PRO A 146 VAL A 153 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 HG1 A THR 142 ? ? H A SER 143 ? ? 1.34 2 19 HG A SER 134 ? ? H A LEU 135 ? ? 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 143 ? ? 74.36 -36.79 2 1 THR A 144 ? ? -97.59 -107.94 3 1 PRO A 146 ? ? -38.42 160.80 4 1 VAL A 153 ? ? 57.59 155.72 5 2 PHE A 126 ? ? -32.92 98.00 6 2 SER A 143 ? ? -61.06 -137.05 7 2 THR A 144 ? ? 59.10 114.81 8 2 PRO A 146 ? ? -69.77 -84.67 9 2 VAL A 153 ? ? 31.54 86.23 10 3 SER A 143 ? ? 47.50 -143.66 11 3 PRO A 146 ? ? -69.71 -166.87 12 3 VAL A 147 ? ? -54.99 -6.87 13 4 PHE A 126 ? ? 60.40 60.50 14 4 SER A 143 ? ? 42.60 -112.38 15 4 ASP A 145 ? ? 41.85 73.94 16 4 VAL A 147 ? ? 33.12 39.89 17 4 VAL A 153 ? ? 56.54 162.17 18 5 SER A 134 ? ? -66.42 -70.27 19 5 SER A 143 ? ? 78.40 130.89 20 5 PRO A 146 ? ? -47.84 175.82 21 5 VAL A 153 ? ? 53.33 -91.67 22 6 PHE A 126 ? ? -171.40 60.81 23 6 ILE A 129 ? ? -56.50 105.59 24 6 SER A 143 ? ? -44.67 157.90 25 6 THR A 144 ? ? -139.52 -106.38 26 6 PRO A 146 ? ? -38.38 162.86 27 6 VAL A 153 ? ? 65.41 -139.62 28 7 ILE A 129 ? ? -64.97 3.33 29 7 THR A 144 ? ? -43.22 167.85 30 7 VAL A 153 ? ? 50.99 93.80 31 8 PRO A 127 ? ? -47.87 175.14 32 8 SER A 143 ? ? 73.89 -49.64 33 8 PRO A 146 ? ? -38.45 163.17 34 8 VAL A 147 ? ? -49.91 171.57 35 8 VAL A 153 ? ? -94.62 -141.11 36 9 ILE A 129 ? ? -44.83 170.97 37 9 SER A 143 ? ? 76.83 -57.32 38 9 PRO A 146 ? ? -38.53 163.34 39 9 VAL A 147 ? ? -45.41 168.71 40 9 VAL A 153 ? ? 55.21 165.31 41 10 PHE A 126 ? ? 179.48 -47.24 42 10 SER A 143 ? ? 53.11 -95.96 43 10 PRO A 146 ? ? -38.27 162.96 44 11 PRO A 127 ? ? -47.71 176.15 45 11 SER A 143 ? ? 56.85 158.71 46 11 PRO A 146 ? ? -68.86 -169.74 47 12 PRO A 127 ? ? -49.58 -175.43 48 12 ILE A 129 ? ? -43.32 102.70 49 12 SER A 143 ? ? 71.20 47.74 50 12 THR A 144 ? ? -84.66 -130.10 51 12 ASP A 145 ? ? -154.08 67.34 52 12 PRO A 146 ? ? -47.81 -178.23 53 12 VAL A 153 ? ? 63.98 112.49 54 13 PHE A 126 ? ? -42.26 162.65 55 13 PRO A 127 ? ? -69.84 88.80 56 13 ILE A 129 ? ? -56.30 -160.66 57 13 THR A 144 ? ? -145.87 -99.35 58 14 PRO A 127 ? ? -73.98 -168.62 59 14 ILE A 129 ? ? -68.18 66.09 60 14 SER A 143 ? ? -172.30 58.02 61 14 THR A 144 ? ? 56.83 164.23 62 14 VAL A 153 ? ? 64.83 141.71 63 15 PHE A 126 ? ? 63.83 60.29 64 15 ILE A 129 ? ? -66.21 72.81 65 15 THR A 144 ? ? -167.13 17.26 66 15 VAL A 153 ? ? 22.32 51.24 67 16 PRO A 127 ? ? -47.87 107.77 68 16 SER A 143 ? ? 75.44 139.36 69 16 THR A 144 ? ? -141.39 -20.24 70 17 SER A 143 ? ? 166.46 172.04 71 17 THR A 144 ? ? -165.00 42.04 72 17 PRO A 146 ? ? -86.66 -87.44 73 17 VAL A 147 ? ? -168.10 -120.79 74 17 VAL A 153 ? ? -172.97 58.49 75 18 PRO A 127 ? ? -46.10 157.40 76 18 ILE A 129 ? ? -60.14 -145.16 77 18 SER A 143 ? ? -41.92 158.16 78 18 ASP A 145 ? ? 178.72 -50.19 79 19 PHE A 126 ? ? -156.24 60.52 80 19 THR A 144 ? ? 55.17 106.98 81 19 ASP A 145 ? ? -175.27 -64.73 82 19 PRO A 146 ? ? -58.48 170.11 83 19 VAL A 153 ? ? 63.31 -135.45 84 20 PHE A 126 ? ? 178.72 -47.15 85 20 PRO A 127 ? ? -56.68 -149.23 86 20 SER A 143 ? ? -42.93 -91.60 87 20 THR A 144 ? ? -141.34 -108.91 88 20 ASP A 145 ? ? -155.50 60.11 89 20 PRO A 146 ? ? -73.56 -167.54 90 20 VAL A 147 ? ? -45.59 94.15 91 21 PHE A 126 ? ? -152.87 67.26 92 21 ILE A 129 ? ? -51.64 101.92 93 21 SER A 143 ? ? 172.42 132.49 94 21 ASP A 145 ? ? -30.46 95.57 95 22 PRO A 127 ? ? -74.09 -168.05 96 22 ILE A 129 ? ? -74.52 40.81 97 22 PRO A 146 ? ? -47.64 179.97 98 22 VAL A 153 ? ? 66.30 153.92 99 23 ILE A 129 ? ? -55.33 99.79 100 23 SER A 143 ? ? 42.75 77.07 101 23 THR A 144 ? ? -138.31 -30.49 102 23 PRO A 146 ? ? -73.85 20.16 103 23 VAL A 147 ? ? -77.08 48.69 104 24 PHE A 126 ? ? -163.98 62.79 105 24 PRO A 127 ? ? -75.70 -165.32 106 24 ILE A 129 ? ? -85.16 32.20 107 24 THR A 144 ? ? 65.89 159.77 108 24 ASP A 145 ? ? -150.59 60.54 109 24 VAL A 153 ? ? -43.79 151.39 110 25 PHE A 126 ? ? -162.30 67.23 111 25 SER A 143 ? ? 60.99 78.24 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M7X _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M7X _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.2-0.7 mM [U-99% 15N] Sod2, 50 v/v CDCl3, 50 v/v 2-propanol, CDCl3/2-propanol' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system CDCl3/2-propanol # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 ? 0.2-0.7 mM '[U-99% 15N]' 1 CDCl3-2 50 ? v/v ? 1 2-propanol-3 50 ? v/v ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'not measured' _pdbx_nmr_exptl_sample_conditions.pH . _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY-HSQC' 1 3 1 '3D 1H-15N TOCSY-HSQC' 1 4 1 '3D HNHA' # _pdbx_nmr_refine.entry_id 2M7X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'peak picking' NMRViewJ ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRViewJ ? 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 120 ? A GLY 1 2 1 Y 1 A SER 121 ? A SER 2 3 1 Y 1 A LYS 122 ? A LYS 3 4 1 Y 1 A LYS 123 ? A LYS 4 5 1 Y 1 A LYS 124 ? A LYS 5 6 1 Y 1 A LYS 155 ? A LYS 36 7 1 Y 1 A LYS 156 ? A LYS 37 8 1 Y 1 A LYS 157 ? A LYS 38 9 2 Y 1 A GLY 120 ? A GLY 1 10 2 Y 1 A SER 121 ? A SER 2 11 2 Y 1 A LYS 122 ? A LYS 3 12 2 Y 1 A LYS 123 ? A LYS 4 13 2 Y 1 A LYS 124 ? A LYS 5 14 2 Y 1 A LYS 155 ? A LYS 36 15 2 Y 1 A LYS 156 ? A LYS 37 16 2 Y 1 A LYS 157 ? A LYS 38 17 3 Y 1 A GLY 120 ? A GLY 1 18 3 Y 1 A SER 121 ? A SER 2 19 3 Y 1 A LYS 122 ? A LYS 3 20 3 Y 1 A LYS 123 ? A LYS 4 21 3 Y 1 A LYS 124 ? A LYS 5 22 3 Y 1 A LYS 155 ? A LYS 36 23 3 Y 1 A LYS 156 ? A LYS 37 24 3 Y 1 A LYS 157 ? A LYS 38 25 4 Y 1 A GLY 120 ? A GLY 1 26 4 Y 1 A SER 121 ? A SER 2 27 4 Y 1 A LYS 122 ? A LYS 3 28 4 Y 1 A LYS 123 ? A LYS 4 29 4 Y 1 A LYS 124 ? A LYS 5 30 4 Y 1 A LYS 155 ? A LYS 36 31 4 Y 1 A LYS 156 ? A LYS 37 32 4 Y 1 A LYS 157 ? A LYS 38 33 5 Y 1 A GLY 120 ? A GLY 1 34 5 Y 1 A SER 121 ? A SER 2 35 5 Y 1 A LYS 122 ? A LYS 3 36 5 Y 1 A LYS 123 ? A LYS 4 37 5 Y 1 A LYS 124 ? A LYS 5 38 5 Y 1 A LYS 155 ? A LYS 36 39 5 Y 1 A LYS 156 ? A LYS 37 40 5 Y 1 A LYS 157 ? A LYS 38 41 6 Y 1 A GLY 120 ? A GLY 1 42 6 Y 1 A SER 121 ? A SER 2 43 6 Y 1 A LYS 122 ? A LYS 3 44 6 Y 1 A LYS 123 ? A LYS 4 45 6 Y 1 A LYS 124 ? A LYS 5 46 6 Y 1 A LYS 155 ? A LYS 36 47 6 Y 1 A LYS 156 ? A LYS 37 48 6 Y 1 A LYS 157 ? A LYS 38 49 7 Y 1 A GLY 120 ? A GLY 1 50 7 Y 1 A SER 121 ? A SER 2 51 7 Y 1 A LYS 122 ? A LYS 3 52 7 Y 1 A LYS 123 ? A LYS 4 53 7 Y 1 A LYS 124 ? A LYS 5 54 7 Y 1 A LYS 155 ? A LYS 36 55 7 Y 1 A LYS 156 ? A LYS 37 56 7 Y 1 A LYS 157 ? A LYS 38 57 8 Y 1 A GLY 120 ? A GLY 1 58 8 Y 1 A SER 121 ? A SER 2 59 8 Y 1 A LYS 122 ? A LYS 3 60 8 Y 1 A LYS 123 ? A LYS 4 61 8 Y 1 A LYS 124 ? A LYS 5 62 8 Y 1 A LYS 155 ? A LYS 36 63 8 Y 1 A LYS 156 ? A LYS 37 64 8 Y 1 A LYS 157 ? A LYS 38 65 9 Y 1 A GLY 120 ? A GLY 1 66 9 Y 1 A SER 121 ? A SER 2 67 9 Y 1 A LYS 122 ? A LYS 3 68 9 Y 1 A LYS 123 ? A LYS 4 69 9 Y 1 A LYS 124 ? A LYS 5 70 9 Y 1 A LYS 155 ? A LYS 36 71 9 Y 1 A LYS 156 ? A LYS 37 72 9 Y 1 A LYS 157 ? A LYS 38 73 10 Y 1 A GLY 120 ? A GLY 1 74 10 Y 1 A SER 121 ? A SER 2 75 10 Y 1 A LYS 122 ? A LYS 3 76 10 Y 1 A LYS 123 ? A LYS 4 77 10 Y 1 A LYS 124 ? A LYS 5 78 10 Y 1 A LYS 155 ? A LYS 36 79 10 Y 1 A LYS 156 ? A LYS 37 80 10 Y 1 A LYS 157 ? A LYS 38 81 11 Y 1 A GLY 120 ? A GLY 1 82 11 Y 1 A SER 121 ? A SER 2 83 11 Y 1 A LYS 122 ? A LYS 3 84 11 Y 1 A LYS 123 ? A LYS 4 85 11 Y 1 A LYS 124 ? A LYS 5 86 11 Y 1 A LYS 155 ? A LYS 36 87 11 Y 1 A LYS 156 ? A LYS 37 88 11 Y 1 A LYS 157 ? A LYS 38 89 12 Y 1 A GLY 120 ? A GLY 1 90 12 Y 1 A SER 121 ? A SER 2 91 12 Y 1 A LYS 122 ? A LYS 3 92 12 Y 1 A LYS 123 ? A LYS 4 93 12 Y 1 A LYS 124 ? A LYS 5 94 12 Y 1 A LYS 155 ? A LYS 36 95 12 Y 1 A LYS 156 ? A LYS 37 96 12 Y 1 A LYS 157 ? A LYS 38 97 13 Y 1 A GLY 120 ? A GLY 1 98 13 Y 1 A SER 121 ? A SER 2 99 13 Y 1 A LYS 122 ? A LYS 3 100 13 Y 1 A LYS 123 ? A LYS 4 101 13 Y 1 A LYS 124 ? A LYS 5 102 13 Y 1 A LYS 155 ? A LYS 36 103 13 Y 1 A LYS 156 ? A LYS 37 104 13 Y 1 A LYS 157 ? A LYS 38 105 14 Y 1 A GLY 120 ? A GLY 1 106 14 Y 1 A SER 121 ? A SER 2 107 14 Y 1 A LYS 122 ? A LYS 3 108 14 Y 1 A LYS 123 ? A LYS 4 109 14 Y 1 A LYS 124 ? A LYS 5 110 14 Y 1 A LYS 155 ? A LYS 36 111 14 Y 1 A LYS 156 ? A LYS 37 112 14 Y 1 A LYS 157 ? A LYS 38 113 15 Y 1 A GLY 120 ? A GLY 1 114 15 Y 1 A SER 121 ? A SER 2 115 15 Y 1 A LYS 122 ? A LYS 3 116 15 Y 1 A LYS 123 ? A LYS 4 117 15 Y 1 A LYS 124 ? A LYS 5 118 15 Y 1 A LYS 155 ? A LYS 36 119 15 Y 1 A LYS 156 ? A LYS 37 120 15 Y 1 A LYS 157 ? A LYS 38 121 16 Y 1 A GLY 120 ? A GLY 1 122 16 Y 1 A SER 121 ? A SER 2 123 16 Y 1 A LYS 122 ? A LYS 3 124 16 Y 1 A LYS 123 ? A LYS 4 125 16 Y 1 A LYS 124 ? A LYS 5 126 16 Y 1 A LYS 155 ? A LYS 36 127 16 Y 1 A LYS 156 ? A LYS 37 128 16 Y 1 A LYS 157 ? A LYS 38 129 17 Y 1 A GLY 120 ? A GLY 1 130 17 Y 1 A SER 121 ? A SER 2 131 17 Y 1 A LYS 122 ? A LYS 3 132 17 Y 1 A LYS 123 ? A LYS 4 133 17 Y 1 A LYS 124 ? A LYS 5 134 17 Y 1 A LYS 155 ? A LYS 36 135 17 Y 1 A LYS 156 ? A LYS 37 136 17 Y 1 A LYS 157 ? A LYS 38 137 18 Y 1 A GLY 120 ? A GLY 1 138 18 Y 1 A SER 121 ? A SER 2 139 18 Y 1 A LYS 122 ? A LYS 3 140 18 Y 1 A LYS 123 ? A LYS 4 141 18 Y 1 A LYS 124 ? A LYS 5 142 18 Y 1 A LYS 155 ? A LYS 36 143 18 Y 1 A LYS 156 ? A LYS 37 144 18 Y 1 A LYS 157 ? A LYS 38 145 19 Y 1 A GLY 120 ? A GLY 1 146 19 Y 1 A SER 121 ? A SER 2 147 19 Y 1 A LYS 122 ? A LYS 3 148 19 Y 1 A LYS 123 ? A LYS 4 149 19 Y 1 A LYS 124 ? A LYS 5 150 19 Y 1 A LYS 155 ? A LYS 36 151 19 Y 1 A LYS 156 ? A LYS 37 152 19 Y 1 A LYS 157 ? A LYS 38 153 20 Y 1 A GLY 120 ? A GLY 1 154 20 Y 1 A SER 121 ? A SER 2 155 20 Y 1 A LYS 122 ? A LYS 3 156 20 Y 1 A LYS 123 ? A LYS 4 157 20 Y 1 A LYS 124 ? A LYS 5 158 20 Y 1 A LYS 155 ? A LYS 36 159 20 Y 1 A LYS 156 ? A LYS 37 160 20 Y 1 A LYS 157 ? A LYS 38 161 21 Y 1 A GLY 120 ? A GLY 1 162 21 Y 1 A SER 121 ? A SER 2 163 21 Y 1 A LYS 122 ? A LYS 3 164 21 Y 1 A LYS 123 ? A LYS 4 165 21 Y 1 A LYS 124 ? A LYS 5 166 21 Y 1 A LYS 155 ? A LYS 36 167 21 Y 1 A LYS 156 ? A LYS 37 168 21 Y 1 A LYS 157 ? A LYS 38 169 22 Y 1 A GLY 120 ? A GLY 1 170 22 Y 1 A SER 121 ? A SER 2 171 22 Y 1 A LYS 122 ? A LYS 3 172 22 Y 1 A LYS 123 ? A LYS 4 173 22 Y 1 A LYS 124 ? A LYS 5 174 22 Y 1 A LYS 155 ? A LYS 36 175 22 Y 1 A LYS 156 ? A LYS 37 176 22 Y 1 A LYS 157 ? A LYS 38 177 23 Y 1 A GLY 120 ? A GLY 1 178 23 Y 1 A SER 121 ? A SER 2 179 23 Y 1 A LYS 122 ? A LYS 3 180 23 Y 1 A LYS 123 ? A LYS 4 181 23 Y 1 A LYS 124 ? A LYS 5 182 23 Y 1 A LYS 155 ? A LYS 36 183 23 Y 1 A LYS 156 ? A LYS 37 184 23 Y 1 A LYS 157 ? A LYS 38 185 24 Y 1 A GLY 120 ? A GLY 1 186 24 Y 1 A SER 121 ? A SER 2 187 24 Y 1 A LYS 122 ? A LYS 3 188 24 Y 1 A LYS 123 ? A LYS 4 189 24 Y 1 A LYS 124 ? A LYS 5 190 24 Y 1 A LYS 155 ? A LYS 36 191 24 Y 1 A LYS 156 ? A LYS 37 192 24 Y 1 A LYS 157 ? A LYS 38 193 25 Y 1 A GLY 120 ? A GLY 1 194 25 Y 1 A SER 121 ? A SER 2 195 25 Y 1 A LYS 122 ? A LYS 3 196 25 Y 1 A LYS 123 ? A LYS 4 197 25 Y 1 A LYS 124 ? A LYS 5 198 25 Y 1 A LYS 155 ? A LYS 36 199 25 Y 1 A LYS 156 ? A LYS 37 200 25 Y 1 A LYS 157 ? A LYS 38 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLY N N N N 81 GLY CA C N N 82 GLY C C N N 83 GLY O O N N 84 GLY OXT O N N 85 GLY H H N N 86 GLY H2 H N N 87 GLY HA2 H N N 88 GLY HA3 H N N 89 GLY HXT H N N 90 ILE N N N N 91 ILE CA C N S 92 ILE C C N N 93 ILE O O N N 94 ILE CB C N S 95 ILE CG1 C N N 96 ILE CG2 C N N 97 ILE CD1 C N N 98 ILE OXT O N N 99 ILE H H N N 100 ILE H2 H N N 101 ILE HA H N N 102 ILE HB H N N 103 ILE HG12 H N N 104 ILE HG13 H N N 105 ILE HG21 H N N 106 ILE HG22 H N N 107 ILE HG23 H N N 108 ILE HD11 H N N 109 ILE HD12 H N N 110 ILE HD13 H N N 111 ILE HXT H N N 112 LEU N N N N 113 LEU CA C N S 114 LEU C C N N 115 LEU O O N N 116 LEU CB C N N 117 LEU CG C N N 118 LEU CD1 C N N 119 LEU CD2 C N N 120 LEU OXT O N N 121 LEU H H N N 122 LEU H2 H N N 123 LEU HA H N N 124 LEU HB2 H N N 125 LEU HB3 H N N 126 LEU HG H N N 127 LEU HD11 H N N 128 LEU HD12 H N N 129 LEU HD13 H N N 130 LEU HD21 H N N 131 LEU HD22 H N N 132 LEU HD23 H N N 133 LEU HXT H N N 134 LYS N N N N 135 LYS CA C N S 136 LYS C C N N 137 LYS O O N N 138 LYS CB C N N 139 LYS CG C N N 140 LYS CD C N N 141 LYS CE C N N 142 LYS NZ N N N 143 LYS OXT O N N 144 LYS H H N N 145 LYS H2 H N N 146 LYS HA H N N 147 LYS HB2 H N N 148 LYS HB3 H N N 149 LYS HG2 H N N 150 LYS HG3 H N N 151 LYS HD2 H N N 152 LYS HD3 H N N 153 LYS HE2 H N N 154 LYS HE3 H N N 155 LYS HZ1 H N N 156 LYS HZ2 H N N 157 LYS HZ3 H N N 158 LYS HXT H N N 159 PHE N N N N 160 PHE CA C N S 161 PHE C C N N 162 PHE O O N N 163 PHE CB C N N 164 PHE CG C Y N 165 PHE CD1 C Y N 166 PHE CD2 C Y N 167 PHE CE1 C Y N 168 PHE CE2 C Y N 169 PHE CZ C Y N 170 PHE OXT O N N 171 PHE H H N N 172 PHE H2 H N N 173 PHE HA H N N 174 PHE HB2 H N N 175 PHE HB3 H N N 176 PHE HD1 H N N 177 PHE HD2 H N N 178 PHE HE1 H N N 179 PHE HE2 H N N 180 PHE HZ H N N 181 PHE HXT H N N 182 PRO N N N N 183 PRO CA C N S 184 PRO C C N N 185 PRO O O N N 186 PRO CB C N N 187 PRO CG C N N 188 PRO CD C N N 189 PRO OXT O N N 190 PRO H H N N 191 PRO HA H N N 192 PRO HB2 H N N 193 PRO HB3 H N N 194 PRO HG2 H N N 195 PRO HG3 H N N 196 PRO HD2 H N N 197 PRO HD3 H N N 198 PRO HXT H N N 199 SER N N N N 200 SER CA C N S 201 SER C C N N 202 SER O O N N 203 SER CB C N N 204 SER OG O N N 205 SER OXT O N N 206 SER H H N N 207 SER H2 H N N 208 SER HA H N N 209 SER HB2 H N N 210 SER HB3 H N N 211 SER HG H N N 212 SER HXT H N N 213 THR N N N N 214 THR CA C N S 215 THR C C N N 216 THR O O N N 217 THR CB C N R 218 THR OG1 O N N 219 THR CG2 C N N 220 THR OXT O N N 221 THR H H N N 222 THR H2 H N N 223 THR HA H N N 224 THR HB H N N 225 THR HG1 H N N 226 THR HG21 H N N 227 THR HG22 H N N 228 THR HG23 H N N 229 THR HXT H N N 230 VAL N N N N 231 VAL CA C N S 232 VAL C C N N 233 VAL O O N N 234 VAL CB C N N 235 VAL CG1 C N N 236 VAL CG2 C N N 237 VAL OXT O N N 238 VAL H H N N 239 VAL H2 H N N 240 VAL HA H N N 241 VAL HB H N N 242 VAL HG11 H N N 243 VAL HG12 H N N 244 VAL HG13 H N N 245 VAL HG21 H N N 246 VAL HG22 H N N 247 VAL HG23 H N N 248 VAL HXT H N N 249 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 ILE N CA sing N N 85 ILE N H sing N N 86 ILE N H2 sing N N 87 ILE CA C sing N N 88 ILE CA CB sing N N 89 ILE CA HA sing N N 90 ILE C O doub N N 91 ILE C OXT sing N N 92 ILE CB CG1 sing N N 93 ILE CB CG2 sing N N 94 ILE CB HB sing N N 95 ILE CG1 CD1 sing N N 96 ILE CG1 HG12 sing N N 97 ILE CG1 HG13 sing N N 98 ILE CG2 HG21 sing N N 99 ILE CG2 HG22 sing N N 100 ILE CG2 HG23 sing N N 101 ILE CD1 HD11 sing N N 102 ILE CD1 HD12 sing N N 103 ILE CD1 HD13 sing N N 104 ILE OXT HXT sing N N 105 LEU N CA sing N N 106 LEU N H sing N N 107 LEU N H2 sing N N 108 LEU CA C sing N N 109 LEU CA CB sing N N 110 LEU CA HA sing N N 111 LEU C O doub N N 112 LEU C OXT sing N N 113 LEU CB CG sing N N 114 LEU CB HB2 sing N N 115 LEU CB HB3 sing N N 116 LEU CG CD1 sing N N 117 LEU CG CD2 sing N N 118 LEU CG HG sing N N 119 LEU CD1 HD11 sing N N 120 LEU CD1 HD12 sing N N 121 LEU CD1 HD13 sing N N 122 LEU CD2 HD21 sing N N 123 LEU CD2 HD22 sing N N 124 LEU CD2 HD23 sing N N 125 LEU OXT HXT sing N N 126 LYS N CA sing N N 127 LYS N H sing N N 128 LYS N H2 sing N N 129 LYS CA C sing N N 130 LYS CA CB sing N N 131 LYS CA HA sing N N 132 LYS C O doub N N 133 LYS C OXT sing N N 134 LYS CB CG sing N N 135 LYS CB HB2 sing N N 136 LYS CB HB3 sing N N 137 LYS CG CD sing N N 138 LYS CG HG2 sing N N 139 LYS CG HG3 sing N N 140 LYS CD CE sing N N 141 LYS CD HD2 sing N N 142 LYS CD HD3 sing N N 143 LYS CE NZ sing N N 144 LYS CE HE2 sing N N 145 LYS CE HE3 sing N N 146 LYS NZ HZ1 sing N N 147 LYS NZ HZ2 sing N N 148 LYS NZ HZ3 sing N N 149 LYS OXT HXT sing N N 150 PHE N CA sing N N 151 PHE N H sing N N 152 PHE N H2 sing N N 153 PHE CA C sing N N 154 PHE CA CB sing N N 155 PHE CA HA sing N N 156 PHE C O doub N N 157 PHE C OXT sing N N 158 PHE CB CG sing N N 159 PHE CB HB2 sing N N 160 PHE CB HB3 sing N N 161 PHE CG CD1 doub Y N 162 PHE CG CD2 sing Y N 163 PHE CD1 CE1 sing Y N 164 PHE CD1 HD1 sing N N 165 PHE CD2 CE2 doub Y N 166 PHE CD2 HD2 sing N N 167 PHE CE1 CZ doub Y N 168 PHE CE1 HE1 sing N N 169 PHE CE2 CZ sing Y N 170 PHE CE2 HE2 sing N N 171 PHE CZ HZ sing N N 172 PHE OXT HXT sing N N 173 PRO N CA sing N N 174 PRO N CD sing N N 175 PRO N H sing N N 176 PRO CA C sing N N 177 PRO CA CB sing N N 178 PRO CA HA sing N N 179 PRO C O doub N N 180 PRO C OXT sing N N 181 PRO CB CG sing N N 182 PRO CB HB2 sing N N 183 PRO CB HB3 sing N N 184 PRO CG CD sing N N 185 PRO CG HG2 sing N N 186 PRO CG HG3 sing N N 187 PRO CD HD2 sing N N 188 PRO CD HD3 sing N N 189 PRO OXT HXT sing N N 190 SER N CA sing N N 191 SER N H sing N N 192 SER N H2 sing N N 193 SER CA C sing N N 194 SER CA CB sing N N 195 SER CA HA sing N N 196 SER C O doub N N 197 SER C OXT sing N N 198 SER CB OG sing N N 199 SER CB HB2 sing N N 200 SER CB HB3 sing N N 201 SER OG HG sing N N 202 SER OXT HXT sing N N 203 THR N CA sing N N 204 THR N H sing N N 205 THR N H2 sing N N 206 THR CA C sing N N 207 THR CA CB sing N N 208 THR CA HA sing N N 209 THR C O doub N N 210 THR C OXT sing N N 211 THR CB OG1 sing N N 212 THR CB CG2 sing N N 213 THR CB HB sing N N 214 THR OG1 HG1 sing N N 215 THR CG2 HG21 sing N N 216 THR CG2 HG22 sing N N 217 THR CG2 HG23 sing N N 218 THR OXT HXT sing N N 219 VAL N CA sing N N 220 VAL N H sing N N 221 VAL N H2 sing N N 222 VAL CA C sing N N 223 VAL CA CB sing N N 224 VAL CA HA sing N N 225 VAL C O doub N N 226 VAL C OXT sing N N 227 VAL CB CG1 sing N N 228 VAL CB CG2 sing N N 229 VAL CB HB sing N N 230 VAL CG1 HG11 sing N N 231 VAL CG1 HG12 sing N N 232 VAL CG1 HG13 sing N N 233 VAL CG2 HG21 sing N N 234 VAL CG2 HG22 sing N N 235 VAL CG2 HG23 sing N N 236 VAL OXT HXT sing N N 237 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2M7X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #