data_2M7Z # _entry.id 2M7Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M7Z pdb_00002m7z 10.2210/pdb2m7z/pdb RCSB RCSB103323 ? ? BMRB 19217 ? ? WWPDB D_1000103323 ? ? # _pdbx_database_related.db_id 19217 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M7Z _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-05-02 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mulvenna, J.' 1 'Jia, X.' 2 # _citation.id primary _citation.title ;Solution structure, membrane interactions, and protein binding partners of the tetraspanin Sm-TSP-2, a vaccine antigen from the human blood fluke Schistosoma mansoni ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 7151 _citation.page_last 7163 _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24429291 _citation.pdbx_database_id_DOI 10.1074/jbc.M113.531558 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jia, X.' 1 ? primary 'Schulte, L.' 2 ? primary 'Loukas, A.' 3 ? primary 'Pickering, D.' 4 ? primary 'Pearson, M.' 5 ? primary 'Mobli, M.' 6 ? primary 'Jones, A.' 7 ? primary 'Rosengren, K.J.' 8 ? primary 'Daly, N.L.' 9 ? primary 'Gobert, G.N.' 10 ? primary 'Jones, M.K.' 11 ? primary 'Craik, D.J.' 12 ? primary 'Mulvenna, J.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CD63-like protein Sm-TSP-2' _entity.formula_weight 9091.350 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 107-184' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSNEKPKVKKHITSALKKLVDKYRNDEHVRKVFDEIQQKLHCCGADSPKDYGENPPTSCSKDGVQFTEGCIKKVSDLSKA H ; _entity_poly.pdbx_seq_one_letter_code_can ;GSNEKPKVKKHITSALKKLVDKYRNDEHVRKVFDEIQQKLHCCGADSPKDYGENPPTSCSKDGVQFTEGCIKKVSDLSKA H ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASN n 1 4 GLU n 1 5 LYS n 1 6 PRO n 1 7 LYS n 1 8 VAL n 1 9 LYS n 1 10 LYS n 1 11 HIS n 1 12 ILE n 1 13 THR n 1 14 SER n 1 15 ALA n 1 16 LEU n 1 17 LYS n 1 18 LYS n 1 19 LEU n 1 20 VAL n 1 21 ASP n 1 22 LYS n 1 23 TYR n 1 24 ARG n 1 25 ASN n 1 26 ASP n 1 27 GLU n 1 28 HIS n 1 29 VAL n 1 30 ARG n 1 31 LYS n 1 32 VAL n 1 33 PHE n 1 34 ASP n 1 35 GLU n 1 36 ILE n 1 37 GLN n 1 38 GLN n 1 39 LYS n 1 40 LEU n 1 41 HIS n 1 42 CYS n 1 43 CYS n 1 44 GLY n 1 45 ALA n 1 46 ASP n 1 47 SER n 1 48 PRO n 1 49 LYS n 1 50 ASP n 1 51 TYR n 1 52 GLY n 1 53 GLU n 1 54 ASN n 1 55 PRO n 1 56 PRO n 1 57 THR n 1 58 SER n 1 59 CYS n 1 60 SER n 1 61 LYS n 1 62 ASP n 1 63 GLY n 1 64 VAL n 1 65 GLN n 1 66 PHE n 1 67 THR n 1 68 GLU n 1 69 GLY n 1 70 CYS n 1 71 ILE n 1 72 LYS n 1 73 LYS n 1 74 VAL n 1 75 SER n 1 76 ASP n 1 77 LEU n 1 78 SER n 1 79 LYS n 1 80 ALA n 1 81 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Blood fluke' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schistosoma mansoni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6183 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pLICMBP _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8ITD7_SCHMA _struct_ref.pdbx_db_accession Q8ITD7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EKPKVKKHITSALKKLVDKYRNDEHVRKVFDEIQQKLHCCGADSPKDYGENPPTSCSKDGVQFTEGCIKKVSDLSKAH _struct_ref.pdbx_align_begin 107 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M7Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8ITD7 _struct_ref_seq.db_align_beg 107 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 184 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M7Z GLY A 1 ? UNP Q8ITD7 ? ? 'expression tag' 1 1 1 2M7Z SER A 2 ? UNP Q8ITD7 ? ? 'expression tag' 2 2 1 2M7Z ASN A 3 ? UNP Q8ITD7 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCA' 1 6 1 '3D HNCACB' 1 7 1 '3D HNCO' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '2D 1H-13C HSQC aliphatic' 1 11 1 '3D 1H-13C NOESY aromatic' 1 12 1 '3D HN(CA)CO' 1 13 1 '4D HCC(CO)NH-TOCSY' 1 14 1 '2D (H)CB-(CGCCTOCSY)-Har' 1 15 1 'Tyr-selective 2D (H)CB-(CGCCTOCSY)-Har' 1 16 1 'Phe-selective 2D (H)CB-(CGCCTOCSY)-Har' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.4mM [U-100% 13C; U-100% 15N] SmTSP2EC2-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M7Z _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M7Z _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M7Z _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 1 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2 ? 'Guntert, Mumenthaler and Wuthrich' collection CYANA 3 ? 'Guntert, Mumenthaler and Wuthrich' processing CYANA 4 ? 'Guntert, Mumenthaler and Wuthrich' 'peak picking' CYANA 5 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 6 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M7Z _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M7Z _struct.title 'Structure of SmTSP2EC2' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M7Z _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Tetraspanin, MEMBRANE PROTEIN, vaccine, schistosomasis' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 8 ? LYS A 10 ? VAL A 8 LYS A 10 5 ? 3 HELX_P HELX_P2 2 HIS A 11 ? LYS A 22 ? HIS A 11 LYS A 22 1 ? 12 HELX_P HELX_P3 3 ASP A 26 ? LEU A 40 ? ASP A 26 LEU A 40 1 ? 15 HELX_P HELX_P4 4 SER A 47 ? GLY A 52 ? SER A 47 GLY A 52 5 ? 6 HELX_P HELX_P5 5 PRO A 56 ? SER A 58 ? PRO A 56 SER A 58 5 ? 3 HELX_P HELX_P6 6 GLY A 69 ? ALA A 80 ? GLY A 69 ALA A 80 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 42 A CYS 70 1_555 ? ? ? ? ? ? ? 1.960 ? ? disulf2 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 43 A CYS 59 1_555 ? ? ? ? ? ? ? 1.964 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 60 ? LYS A 61 ? SER A 60 LYS A 61 A 2 VAL A 64 ? GLN A 65 ? VAL A 64 GLN A 65 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 61 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 61 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 64 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 64 # _atom_sites.entry_id 2M7Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 HIS 81 81 81 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-01-22 2 'Structure model' 1 1 2016-06-01 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component SmTSP2EC2-1 _pdbx_nmr_exptl_sample.concentration 1.4 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 53 ? ? -146.81 19.41 2 1 ASN A 54 ? ? -157.74 75.33 3 1 THR A 67 ? ? -90.63 46.02 4 2 ASN A 3 ? ? -172.88 131.39 5 2 GLU A 53 ? ? -142.02 25.80 6 2 ASN A 54 ? ? -164.95 73.92 7 2 THR A 67 ? ? -98.41 34.72 8 3 ASN A 3 ? ? -173.78 149.90 9 3 LYS A 10 ? ? -92.82 -66.96 10 3 GLU A 53 ? ? -142.06 22.46 11 3 ASN A 54 ? ? -158.52 75.23 12 4 GLU A 53 ? ? -140.19 29.87 13 4 ASN A 54 ? ? -163.88 75.05 14 4 THR A 67 ? ? -90.70 46.02 15 5 GLU A 53 ? ? -148.09 20.40 16 5 ASN A 54 ? ? -158.59 75.04 17 5 THR A 67 ? ? -90.56 45.92 18 6 GLU A 4 ? ? -103.27 45.00 19 6 ASN A 54 ? ? -158.69 73.82 20 6 THR A 67 ? ? -93.31 40.81 21 7 ASN A 3 ? ? -170.88 147.97 22 7 ALA A 45 ? ? -77.28 -71.59 23 7 ASN A 54 ? ? -167.68 73.80 24 8 ASN A 3 ? ? -116.71 58.03 25 9 LYS A 10 ? ? -93.68 -61.55 26 9 ASN A 54 ? ? -158.34 73.47 27 10 ASN A 3 ? ? -62.81 99.65 28 10 THR A 67 ? ? -90.87 45.94 29 11 LYS A 10 ? ? -93.37 -65.72 30 11 GLU A 53 ? ? -145.43 20.12 31 11 ASN A 54 ? ? -158.11 74.73 32 11 LYS A 79 ? ? -96.68 40.27 33 12 ASN A 54 ? ? -171.17 74.82 34 12 THR A 67 ? ? -90.50 45.94 35 13 LYS A 10 ? ? -93.57 -64.42 36 13 GLU A 53 ? ? -140.20 20.63 37 13 ASN A 54 ? ? -157.15 74.58 38 13 THR A 67 ? ? -90.83 46.05 39 13 LYS A 79 ? ? -96.53 33.44 40 14 ASN A 3 ? ? -110.58 78.64 41 14 ASN A 54 ? ? -157.72 74.97 42 14 THR A 67 ? ? -91.00 45.88 43 15 ASN A 54 ? ? -157.82 73.77 44 16 GLU A 53 ? ? -140.80 22.17 45 16 ASN A 54 ? ? -157.78 74.83 46 16 THR A 67 ? ? -90.95 45.90 47 17 GLU A 53 ? ? -140.15 19.32 48 17 ASN A 54 ? ? -157.91 74.01 49 17 THR A 67 ? ? -90.92 45.64 50 18 SER A 2 ? ? -105.41 45.22 51 18 GLU A 53 ? ? -143.21 23.63 52 18 ASN A 54 ? ? -156.91 75.81 53 19 ASN A 3 ? ? -121.56 -59.85 54 19 ASN A 54 ? ? -157.73 73.32 55 19 LYS A 79 ? ? -96.29 33.60 56 20 SER A 2 ? ? -115.70 63.16 57 20 ASN A 54 ? ? -162.81 74.65 #