data_2M80 # _entry.id 2M80 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M80 pdb_00002m80 10.2210/pdb2m80/pdb RCSB RCSB103324 ? ? BMRB 19218 ? 10.13018/BMR19218 WWPDB D_1000103324 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-07 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M80 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-05-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 19218 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tang, Y.' 1 ? 'Zhang, J.' 2 ? 'Yu, J.' 3 ? 'Wu, J.' 4 ? 'Zhou, C.Z.' 5 ? 'Shi, Y.' 6 ? # _citation.id primary _citation.title 'Structure-guided activity enhancement and catalytic mechanism of yeast grx8' _citation.journal_abbrev Biochemistry _citation.journal_volume 53 _citation.page_first 2185 _citation.page_last 2196 _citation.year 2014 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24611845 _citation.pdbx_database_id_DOI 10.1021/bi401293s # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tang, Y.' 1 ? primary 'Zhang, J.' 2 ? primary 'Yu, J.' 3 ? primary 'Xu, L.' 4 ? primary 'Wu, J.' 5 ? primary 'Zhou, C.Z.' 6 ? primary 'Shi, Y.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Glutaredoxin-8 _entity.formula_weight 13551.499 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Glutathione-dependent oxidoreductase 8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHMSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRN LPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHMSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRN LPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 SER n 1 11 ALA n 1 12 PHE n 1 13 VAL n 1 14 THR n 1 15 LYS n 1 16 ALA n 1 17 GLU n 1 18 GLU n 1 19 MET n 1 20 ILE n 1 21 LYS n 1 22 SER n 1 23 HIS n 1 24 PRO n 1 25 TYR n 1 26 PHE n 1 27 GLN n 1 28 LEU n 1 29 SER n 1 30 ALA n 1 31 SER n 1 32 TRP n 1 33 CYS n 1 34 PRO n 1 35 ASP n 1 36 CYS n 1 37 VAL n 1 38 TYR n 1 39 ALA n 1 40 ASN n 1 41 SER n 1 42 ILE n 1 43 TRP n 1 44 ASN n 1 45 LYS n 1 46 LEU n 1 47 ASN n 1 48 VAL n 1 49 GLN n 1 50 ASP n 1 51 LYS n 1 52 VAL n 1 53 PHE n 1 54 VAL n 1 55 PHE n 1 56 ASP n 1 57 ILE n 1 58 GLY n 1 59 SER n 1 60 LEU n 1 61 PRO n 1 62 ARG n 1 63 ASN n 1 64 GLU n 1 65 GLN n 1 66 GLU n 1 67 LYS n 1 68 TRP n 1 69 ARG n 1 70 ILE n 1 71 ALA n 1 72 PHE n 1 73 GLN n 1 74 LYS n 1 75 VAL n 1 76 VAL n 1 77 GLY n 1 78 SER n 1 79 ARG n 1 80 ASN n 1 81 LEU n 1 82 PRO n 1 83 THR n 1 84 ILE n 1 85 VAL n 1 86 VAL n 1 87 ASN n 1 88 GLY n 1 89 LYS n 1 90 PHE n 1 91 TRP n 1 92 GLY n 1 93 THR n 1 94 GLU n 1 95 SER n 1 96 GLN n 1 97 LEU n 1 98 HIS n 1 99 ARG n 1 100 PHE n 1 101 GLU n 1 102 ALA n 1 103 LYS n 1 104 GLY n 1 105 THR n 1 106 LEU n 1 107 GLU n 1 108 GLU n 1 109 GLU n 1 110 LEU n 1 111 THR n 1 112 LYS n 1 113 ILE n 1 114 GLY n 1 115 LEU n 1 116 LEU n 1 117 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GRX8 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain S288c _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector p28 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 TRP 68 68 68 TRP TRP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 PRO 117 117 117 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M80 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M80 _struct.title 'Solution structure of yeast dithiol glutaredoxin Grx8' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M80 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;Biomolecular, Glutaredoxins, Glutathione, Glutathione Disulfide, Saccharomyces cerevisiae, Oxidation-Reduction, Tertiary, GSH-dependenet oxidoreductase, Electron Transport, OXIDOREDUCTASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLRX8_YEAST _struct_ref.pdbx_db_accession Q05926 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRNLPTIVVNG KFWGTESQLHRFEAKGTLEEELTKIGLLP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M80 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05926 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 9 _struct_ref_seq.pdbx_auth_seq_align_end 117 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M80 MET A 1 ? UNP Q05926 ? ? 'expression tag' 1 1 1 2M80 GLY A 2 ? UNP Q05926 ? ? 'expression tag' 2 2 1 2M80 HIS A 3 ? UNP Q05926 ? ? 'expression tag' 3 3 1 2M80 HIS A 4 ? UNP Q05926 ? ? 'expression tag' 4 4 1 2M80 HIS A 5 ? UNP Q05926 ? ? 'expression tag' 5 5 1 2M80 HIS A 6 ? UNP Q05926 ? ? 'expression tag' 6 6 1 2M80 HIS A 7 ? UNP Q05926 ? ? 'expression tag' 7 7 1 2M80 HIS A 8 ? UNP Q05926 ? ? 'expression tag' 8 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 12 ? HIS A 23 ? PHE A 12 HIS A 23 1 ? 12 HELX_P HELX_P2 2 ASP A 35 ? ASN A 47 ? ASP A 35 ASN A 47 1 ? 13 HELX_P HELX_P3 3 PRO A 61 ? VAL A 76 ? PRO A 61 VAL A 76 1 ? 16 HELX_P HELX_P4 4 THR A 93 ? GLY A 104 ? THR A 93 GLY A 104 1 ? 12 HELX_P HELX_P5 5 THR A 105 ? ILE A 113 ? THR A 105 ILE A 113 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 1 0.19 2 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 2 0.21 3 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 3 0.04 4 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 4 0.30 5 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 5 0.17 6 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 6 -0.11 7 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 7 0.08 8 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 8 0.12 9 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 9 0.08 10 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 10 0.07 11 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 11 0.03 12 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 12 0.31 13 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 13 0.12 14 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 14 0.14 15 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 15 -0.12 16 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 16 0.32 17 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 17 0.26 18 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 18 -0.03 19 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 19 0.10 20 LEU 81 A . ? LEU 81 A PRO 82 A ? PRO 82 A 20 0.12 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 53 ? ASP A 56 ? PHE A 53 ASP A 56 A 2 PHE A 26 ? SER A 29 ? PHE A 26 SER A 29 A 3 THR A 83 ? VAL A 86 ? THR A 83 VAL A 86 A 4 LYS A 89 ? GLY A 92 ? LYS A 89 GLY A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 55 ? O PHE A 55 N GLN A 27 ? N GLN A 27 A 2 3 N PHE A 26 ? N PHE A 26 O VAL A 85 ? O VAL A 85 A 3 4 N VAL A 86 ? N VAL A 86 O LYS A 89 ? O LYS A 89 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 10 ? ? 72.90 -61.54 2 1 TRP A 32 ? ? -151.72 72.37 3 1 PRO A 61 ? ? -62.93 -174.73 4 1 VAL A 76 ? ? -135.15 -44.65 5 1 ARG A 79 ? ? -94.63 38.62 6 1 LYS A 89 ? ? -174.15 138.63 7 2 ARG A 79 ? ? -94.04 43.36 8 2 LYS A 89 ? ? -171.84 134.01 9 3 HIS A 23 ? ? -118.46 66.42 10 3 ILE A 57 ? ? -122.49 -144.00 11 3 SER A 59 ? ? -149.10 33.81 12 3 PRO A 61 ? ? -62.19 -170.80 13 3 ARG A 79 ? ? -93.40 40.21 14 3 LYS A 89 ? ? -175.44 137.41 15 3 PHE A 90 ? ? -59.15 102.21 16 4 SER A 10 ? ? -173.97 -50.63 17 4 TRP A 32 ? ? -159.36 -41.00 18 4 GLN A 49 ? ? -99.69 31.34 19 4 PRO A 61 ? ? -68.30 -172.94 20 4 VAL A 76 ? ? -147.92 -37.27 21 4 SER A 78 ? ? 61.34 -166.19 22 4 ARG A 79 ? ? -95.33 40.54 23 4 LYS A 89 ? ? -173.12 137.76 24 4 PHE A 90 ? ? -57.56 108.38 25 5 HIS A 23 ? ? -119.72 66.17 26 5 SER A 59 ? ? -96.06 37.36 27 5 PRO A 61 ? ? -62.65 -176.85 28 5 ARG A 79 ? ? -95.88 38.08 29 5 PHE A 90 ? ? -59.74 102.37 30 6 HIS A 23 ? ? -119.78 66.27 31 6 TRP A 32 ? ? -153.34 32.16 32 6 SER A 59 ? ? -140.73 57.49 33 6 PRO A 61 ? ? -76.19 -169.80 34 6 ARG A 79 ? ? -96.82 38.86 35 6 LYS A 89 ? ? -173.40 138.40 36 6 PHE A 90 ? ? -61.97 94.99 37 7 HIS A 23 ? ? -119.39 68.53 38 7 ILE A 57 ? ? -112.77 78.30 39 7 SER A 59 ? ? -95.55 37.83 40 7 LYS A 89 ? ? -174.16 134.99 41 8 ALA A 30 ? ? -92.68 -82.17 42 8 SER A 31 ? ? -176.66 -62.91 43 8 VAL A 48 ? ? -141.23 41.63 44 8 ARG A 79 ? ? -92.22 39.43 45 8 LYS A 89 ? ? -175.24 136.64 46 8 PHE A 90 ? ? -58.98 109.20 47 9 SER A 10 ? ? 74.43 -57.58 48 9 SER A 31 ? ? -94.88 36.73 49 9 TRP A 32 ? ? -144.66 -48.55 50 9 PRO A 61 ? ? -67.79 -173.54 51 9 ARG A 79 ? ? -93.49 34.69 52 9 LYS A 89 ? ? -176.15 135.94 53 9 PHE A 90 ? ? -59.49 107.11 54 10 TRP A 32 ? ? -154.23 -48.94 55 10 SER A 59 ? ? -150.35 24.82 56 10 LEU A 60 ? ? -171.79 58.28 57 10 ARG A 62 ? ? 64.60 -75.48 58 10 ARG A 79 ? ? -92.63 37.11 59 10 LYS A 89 ? ? -176.51 136.97 60 10 PHE A 90 ? ? -59.22 102.30 61 11 SER A 59 ? ? -145.90 -83.50 62 11 LEU A 60 ? ? 60.52 105.34 63 11 PRO A 61 ? ? -66.36 62.50 64 11 ARG A 62 ? ? 62.21 -73.18 65 11 VAL A 76 ? ? -134.39 -43.98 66 11 LYS A 89 ? ? -172.39 135.67 67 12 TRP A 32 ? ? -142.09 -53.65 68 12 PRO A 61 ? ? -81.54 45.10 69 12 ARG A 62 ? ? 67.47 -57.80 70 12 ARG A 79 ? ? -96.40 39.27 71 12 LYS A 89 ? ? -174.31 136.68 72 12 PHE A 90 ? ? -55.05 106.15 73 13 GLN A 49 ? ? -99.27 30.73 74 13 ASP A 50 ? ? -124.05 -50.42 75 13 PRO A 61 ? ? -62.14 -167.44 76 13 ARG A 79 ? ? -91.22 31.06 77 13 LYS A 89 ? ? -171.99 134.87 78 14 SER A 10 ? ? -125.48 -50.31 79 14 ALA A 30 ? ? 69.32 118.81 80 14 SER A 31 ? ? -177.50 -48.62 81 14 TRP A 32 ? ? -166.65 34.75 82 14 ARG A 79 ? ? -99.10 42.27 83 14 LYS A 89 ? ? -172.84 136.18 84 15 LYS A 89 ? ? -175.12 135.06 85 16 ARG A 79 ? ? -86.52 49.99 86 16 LYS A 89 ? ? -173.21 136.21 87 17 TRP A 32 ? ? -161.31 -44.38 88 17 PRO A 61 ? ? -62.76 -171.61 89 17 SER A 78 ? ? -178.44 75.80 90 17 LYS A 89 ? ? -175.90 137.37 91 18 HIS A 23 ? ? -119.72 68.37 92 18 SER A 59 ? ? -141.20 42.55 93 18 SER A 78 ? ? -163.52 93.53 94 18 ARG A 79 ? ? -97.61 34.08 95 18 LYS A 89 ? ? -172.65 134.56 96 19 TRP A 32 ? ? -134.09 -47.04 97 19 SER A 59 ? ? -155.57 36.10 98 19 PRO A 61 ? ? -57.44 174.82 99 19 ARG A 79 ? ? -94.82 37.66 100 19 GLU A 94 ? ? -86.91 49.23 101 19 SER A 95 ? ? -172.84 -43.05 102 20 HIS A 23 ? ? -118.58 64.29 103 20 GLN A 49 ? ? -97.02 30.20 104 20 ILE A 57 ? ? -114.31 69.75 105 20 PRO A 61 ? ? -62.63 -172.00 106 20 VAL A 76 ? ? -144.45 -41.79 107 20 SER A 78 ? ? -96.99 44.81 108 20 LYS A 89 ? ? -173.41 136.12 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M80 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M80 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM sodium phosphate-1, 50 mM sodium chloride-2, 2 mM DTT-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '20 mM sodium phosphate-4, 50 mM sodium chloride-5, 2 mM DTT-6, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 50 ? mM ? 1 DTT-3 2 ? mM ? 1 'sodium phosphate-4' 20 ? mM ? 2 'sodium chloride-5' 50 ? mM ? 2 DTT-6 2 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HCCH-COSY' 1 3 2 '3D HCCH-TOCSY' 1 4 2 '3D 1H-13C NOESY' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D C(CO)NH' 1 7 1 '3D HNCO' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HNCACB' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D 1H-15N NOESY' # _pdbx_nmr_refine.entry_id 2M80 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 2 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRDraw 3 ? Goddard 'chemical shift assignment' Sparky 4 ? Goddard 'chemical shift calculation' Sparky 5 ? Goddard 'peak picking' Sparky 6 ? 'Laskowski and MacArthur' refinement ProcheckNMR 7 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 2 Y 1 A MET 1 ? A MET 1 10 2 Y 1 A GLY 2 ? A GLY 2 11 2 Y 1 A HIS 3 ? A HIS 3 12 2 Y 1 A HIS 4 ? A HIS 4 13 2 Y 1 A HIS 5 ? A HIS 5 14 2 Y 1 A HIS 6 ? A HIS 6 15 2 Y 1 A HIS 7 ? A HIS 7 16 2 Y 1 A HIS 8 ? A HIS 8 17 3 Y 1 A MET 1 ? A MET 1 18 3 Y 1 A GLY 2 ? A GLY 2 19 3 Y 1 A HIS 3 ? A HIS 3 20 3 Y 1 A HIS 4 ? A HIS 4 21 3 Y 1 A HIS 5 ? A HIS 5 22 3 Y 1 A HIS 6 ? A HIS 6 23 3 Y 1 A HIS 7 ? A HIS 7 24 3 Y 1 A HIS 8 ? A HIS 8 25 4 Y 1 A MET 1 ? A MET 1 26 4 Y 1 A GLY 2 ? A GLY 2 27 4 Y 1 A HIS 3 ? A HIS 3 28 4 Y 1 A HIS 4 ? A HIS 4 29 4 Y 1 A HIS 5 ? A HIS 5 30 4 Y 1 A HIS 6 ? A HIS 6 31 4 Y 1 A HIS 7 ? A HIS 7 32 4 Y 1 A HIS 8 ? A HIS 8 33 5 Y 1 A MET 1 ? A MET 1 34 5 Y 1 A GLY 2 ? A GLY 2 35 5 Y 1 A HIS 3 ? A HIS 3 36 5 Y 1 A HIS 4 ? A HIS 4 37 5 Y 1 A HIS 5 ? A HIS 5 38 5 Y 1 A HIS 6 ? A HIS 6 39 5 Y 1 A HIS 7 ? A HIS 7 40 5 Y 1 A HIS 8 ? A HIS 8 41 6 Y 1 A MET 1 ? A MET 1 42 6 Y 1 A GLY 2 ? A GLY 2 43 6 Y 1 A HIS 3 ? A HIS 3 44 6 Y 1 A HIS 4 ? A HIS 4 45 6 Y 1 A HIS 5 ? A HIS 5 46 6 Y 1 A HIS 6 ? A HIS 6 47 6 Y 1 A HIS 7 ? A HIS 7 48 6 Y 1 A HIS 8 ? A HIS 8 49 7 Y 1 A MET 1 ? A MET 1 50 7 Y 1 A GLY 2 ? A GLY 2 51 7 Y 1 A HIS 3 ? A HIS 3 52 7 Y 1 A HIS 4 ? A HIS 4 53 7 Y 1 A HIS 5 ? A HIS 5 54 7 Y 1 A HIS 6 ? A HIS 6 55 7 Y 1 A HIS 7 ? A HIS 7 56 7 Y 1 A HIS 8 ? A HIS 8 57 8 Y 1 A MET 1 ? A MET 1 58 8 Y 1 A GLY 2 ? A GLY 2 59 8 Y 1 A HIS 3 ? A HIS 3 60 8 Y 1 A HIS 4 ? A HIS 4 61 8 Y 1 A HIS 5 ? A HIS 5 62 8 Y 1 A HIS 6 ? A HIS 6 63 8 Y 1 A HIS 7 ? A HIS 7 64 8 Y 1 A HIS 8 ? A HIS 8 65 9 Y 1 A MET 1 ? A MET 1 66 9 Y 1 A GLY 2 ? A GLY 2 67 9 Y 1 A HIS 3 ? A HIS 3 68 9 Y 1 A HIS 4 ? A HIS 4 69 9 Y 1 A HIS 5 ? A HIS 5 70 9 Y 1 A HIS 6 ? A HIS 6 71 9 Y 1 A HIS 7 ? A HIS 7 72 9 Y 1 A HIS 8 ? A HIS 8 73 10 Y 1 A MET 1 ? A MET 1 74 10 Y 1 A GLY 2 ? A GLY 2 75 10 Y 1 A HIS 3 ? A HIS 3 76 10 Y 1 A HIS 4 ? A HIS 4 77 10 Y 1 A HIS 5 ? A HIS 5 78 10 Y 1 A HIS 6 ? A HIS 6 79 10 Y 1 A HIS 7 ? A HIS 7 80 10 Y 1 A HIS 8 ? A HIS 8 81 11 Y 1 A MET 1 ? A MET 1 82 11 Y 1 A GLY 2 ? A GLY 2 83 11 Y 1 A HIS 3 ? A HIS 3 84 11 Y 1 A HIS 4 ? A HIS 4 85 11 Y 1 A HIS 5 ? A HIS 5 86 11 Y 1 A HIS 6 ? A HIS 6 87 11 Y 1 A HIS 7 ? A HIS 7 88 11 Y 1 A HIS 8 ? A HIS 8 89 12 Y 1 A MET 1 ? A MET 1 90 12 Y 1 A GLY 2 ? A GLY 2 91 12 Y 1 A HIS 3 ? A HIS 3 92 12 Y 1 A HIS 4 ? A HIS 4 93 12 Y 1 A HIS 5 ? A HIS 5 94 12 Y 1 A HIS 6 ? A HIS 6 95 12 Y 1 A HIS 7 ? A HIS 7 96 12 Y 1 A HIS 8 ? A HIS 8 97 13 Y 1 A MET 1 ? A MET 1 98 13 Y 1 A GLY 2 ? A GLY 2 99 13 Y 1 A HIS 3 ? A HIS 3 100 13 Y 1 A HIS 4 ? A HIS 4 101 13 Y 1 A HIS 5 ? A HIS 5 102 13 Y 1 A HIS 6 ? A HIS 6 103 13 Y 1 A HIS 7 ? A HIS 7 104 13 Y 1 A HIS 8 ? A HIS 8 105 14 Y 1 A MET 1 ? A MET 1 106 14 Y 1 A GLY 2 ? A GLY 2 107 14 Y 1 A HIS 3 ? A HIS 3 108 14 Y 1 A HIS 4 ? A HIS 4 109 14 Y 1 A HIS 5 ? A HIS 5 110 14 Y 1 A HIS 6 ? A HIS 6 111 14 Y 1 A HIS 7 ? A HIS 7 112 14 Y 1 A HIS 8 ? A HIS 8 113 15 Y 1 A MET 1 ? A MET 1 114 15 Y 1 A GLY 2 ? A GLY 2 115 15 Y 1 A HIS 3 ? A HIS 3 116 15 Y 1 A HIS 4 ? A HIS 4 117 15 Y 1 A HIS 5 ? A HIS 5 118 15 Y 1 A HIS 6 ? A HIS 6 119 15 Y 1 A HIS 7 ? A HIS 7 120 15 Y 1 A HIS 8 ? A HIS 8 121 16 Y 1 A MET 1 ? A MET 1 122 16 Y 1 A GLY 2 ? A GLY 2 123 16 Y 1 A HIS 3 ? A HIS 3 124 16 Y 1 A HIS 4 ? A HIS 4 125 16 Y 1 A HIS 5 ? A HIS 5 126 16 Y 1 A HIS 6 ? A HIS 6 127 16 Y 1 A HIS 7 ? A HIS 7 128 16 Y 1 A HIS 8 ? A HIS 8 129 17 Y 1 A MET 1 ? A MET 1 130 17 Y 1 A GLY 2 ? A GLY 2 131 17 Y 1 A HIS 3 ? A HIS 3 132 17 Y 1 A HIS 4 ? A HIS 4 133 17 Y 1 A HIS 5 ? A HIS 5 134 17 Y 1 A HIS 6 ? A HIS 6 135 17 Y 1 A HIS 7 ? A HIS 7 136 17 Y 1 A HIS 8 ? A HIS 8 137 18 Y 1 A MET 1 ? A MET 1 138 18 Y 1 A GLY 2 ? A GLY 2 139 18 Y 1 A HIS 3 ? A HIS 3 140 18 Y 1 A HIS 4 ? A HIS 4 141 18 Y 1 A HIS 5 ? A HIS 5 142 18 Y 1 A HIS 6 ? A HIS 6 143 18 Y 1 A HIS 7 ? A HIS 7 144 18 Y 1 A HIS 8 ? A HIS 8 145 19 Y 1 A MET 1 ? A MET 1 146 19 Y 1 A GLY 2 ? A GLY 2 147 19 Y 1 A HIS 3 ? A HIS 3 148 19 Y 1 A HIS 4 ? A HIS 4 149 19 Y 1 A HIS 5 ? A HIS 5 150 19 Y 1 A HIS 6 ? A HIS 6 151 19 Y 1 A HIS 7 ? A HIS 7 152 19 Y 1 A HIS 8 ? A HIS 8 153 20 Y 1 A MET 1 ? A MET 1 154 20 Y 1 A GLY 2 ? A GLY 2 155 20 Y 1 A HIS 3 ? A HIS 3 156 20 Y 1 A HIS 4 ? A HIS 4 157 20 Y 1 A HIS 5 ? A HIS 5 158 20 Y 1 A HIS 6 ? A HIS 6 159 20 Y 1 A HIS 7 ? A HIS 7 160 20 Y 1 A HIS 8 ? A HIS 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2M80 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_