data_2M8H # _entry.id 2M8H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M8H RCSB RCSB103341 BMRB 19252 WWPDB D_1000103341 # _pdbx_database_related.db_id 19252 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M8H _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-05-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sikorsky, T.' 1 'Hrossova, D.' 2 'Vanacova, S.' 3 'Stefl, R.' 4 # _citation.id primary _citation.title 'RNA binding properties of the human NEXT complex' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Sikorsky, T.' 1 primary 'Stefl, R.' 2 primary 'Hrossova, D.' 3 primary 'Vanacova, S.' 4 # _cell.entry_id 2M8H _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M8H _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RNA-binding protein 7' _entity.formula_weight 11473.180 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'unp residues 4-94' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-binding motif protein 7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGI KLYGRPIKIQFRSGSSHAPQD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGI KLYGRPIKIQFRSGSSHAPQD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 PHE n 1 5 GLU n 1 6 LEU n 1 7 ARG n 1 8 ARG n 1 9 GLN n 1 10 GLN n 1 11 ALA n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 ALA n 1 16 ASP n 1 17 ARG n 1 18 THR n 1 19 LEU n 1 20 PHE n 1 21 VAL n 1 22 GLY n 1 23 ASN n 1 24 LEU n 1 25 GLU n 1 26 THR n 1 27 LYS n 1 28 VAL n 1 29 THR n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 LEU n 1 34 PHE n 1 35 GLU n 1 36 LEU n 1 37 PHE n 1 38 HIS n 1 39 GLN n 1 40 ALA n 1 41 GLY n 1 42 PRO n 1 43 VAL n 1 44 ILE n 1 45 LYS n 1 46 VAL n 1 47 LYS n 1 48 ILE n 1 49 PRO n 1 50 LYS n 1 51 ASP n 1 52 LYS n 1 53 ASP n 1 54 GLY n 1 55 LYS n 1 56 PRO n 1 57 LYS n 1 58 GLN n 1 59 PHE n 1 60 ALA n 1 61 PHE n 1 62 VAL n 1 63 ASN n 1 64 PHE n 1 65 LYS n 1 66 HIS n 1 67 GLU n 1 68 VAL n 1 69 SER n 1 70 VAL n 1 71 PRO n 1 72 TYR n 1 73 ALA n 1 74 MET n 1 75 ASN n 1 76 LEU n 1 77 LEU n 1 78 ASN n 1 79 GLY n 1 80 ILE n 1 81 LYS n 1 82 LEU n 1 83 TYR n 1 84 GLY n 1 85 ARG n 1 86 PRO n 1 87 ILE n 1 88 LYS n 1 89 ILE n 1 90 GLN n 1 91 PHE n 1 92 ARG n 1 93 SER n 1 94 GLY n 1 95 SER n 1 96 SER n 1 97 HIS n 1 98 ALA n 1 99 PRO n 1 100 GLN n 1 101 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RBM7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RBM7_HUMAN _struct_ref.pdbx_db_accession Q9Y580 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQ FRSGSSHAPQD ; _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M8H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y580 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M8H GLY A 1 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 1 1 1 2M8H SER A 2 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 2 2 1 2M8H GLU A 3 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 3 3 1 2M8H PHE A 4 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 4 4 1 2M8H GLU A 5 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 5 5 1 2M8H LEU A 6 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 6 6 1 2M8H ARG A 7 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 7 7 1 2M8H ARG A 8 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 8 8 1 2M8H GLN A 9 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 9 9 1 2M8H GLN A 10 ? UNP Q9Y580 ? ? 'EXPRESSION TAG' 10 10 1 2M8H LEU A 12 ? UNP Q9Y580 ALA 5 CONFLICT 12 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HBHA(CO)NH' 1 3 1 '3D HNCA' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.3 mM [U-99% 13C; U-99% 15N] RBM7, 20 mM BISTRIS, 4 mM beta-mercaptoethanol, 200 mM sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker Avance 1 'Bruker Avance' 950 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M8H _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M8H _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M8H _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 1 'Case, Darden, Cheatham iii, Simmerling, Wang, duke, Luo, and Kollman' refinement AMBER ? 2 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M8H _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M8H _struct.title 'RRM domain of human RBM7' _struct.pdbx_descriptor 'RNA-binding protein 7' _struct.pdbx_model_details 'closest to the average, model5' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M8H _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'BINDING PROTEIN, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 29 ? HIS A 38 ? THR A 29 HIS A 38 1 ? 10 HELX_P HELX_P2 2 TYR A 72 ? LEU A 77 ? TYR A 72 LEU A 77 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 43 ? LYS A 47 ? VAL A 43 LYS A 47 A 2 PHE A 59 ? PHE A 64 ? PHE A 59 PHE A 64 A 3 THR A 18 ? GLY A 22 ? THR A 18 GLY A 22 A 4 LYS A 88 ? GLN A 90 ? LYS A 88 GLN A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 45 ? N LYS A 45 O ASN A 63 ? O ASN A 63 A 2 3 O VAL A 62 ? O VAL A 62 N LEU A 19 ? N LEU A 19 A 3 4 N GLY A 22 ? N GLY A 22 O LYS A 88 ? O LYS A 88 # _atom_sites.entry_id 2M8H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ASP 101 101 101 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-01-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RBM7-1 0.3 ? mM '[U-99% 13C; U-99% 15N]' 1 BISTRIS-2 20 ? mM ? 1 beta-mercaptoethanol-3 4 ? mM ? 1 'sodium chloride-4' 200 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M8H _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1633 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 126.33 120.30 6.03 0.50 N 2 1 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 125.75 120.30 5.45 0.50 N 3 1 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 116.86 120.30 -3.44 0.50 N 4 1 CB A TYR 83 ? ? CG A TYR 83 ? ? CD2 A TYR 83 ? ? 117.38 121.00 -3.62 0.60 N 5 1 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 125.03 120.30 4.73 0.50 N 6 2 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 125.98 120.30 5.68 0.50 N 7 2 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.99 120.30 3.69 0.50 N 8 2 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 124.24 120.30 3.94 0.50 N 9 2 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 123.62 120.30 3.32 0.50 N 10 3 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.94 120.30 3.64 0.50 N 11 3 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 125.42 120.30 5.12 0.50 N 12 3 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 116.53 120.30 -3.77 0.50 N 13 3 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 125.70 120.30 5.40 0.50 N 14 3 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 125.14 120.30 4.84 0.50 N 15 3 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH2 A ARG 92 ? ? 116.13 120.30 -4.17 0.50 N 16 4 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.71 120.30 6.41 0.50 N 17 4 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 125.50 120.30 5.20 0.50 N 18 4 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 125.46 120.30 5.16 0.50 N 19 4 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 116.81 120.30 -3.49 0.50 N 20 4 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 127.05 120.30 6.75 0.50 N 21 5 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.69 120.30 4.39 0.50 N 22 5 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH2 A ARG 8 ? ? 116.83 120.30 -3.47 0.50 N 23 5 CB A TYR 83 ? ? CG A TYR 83 ? ? CD2 A TYR 83 ? ? 116.80 121.00 -4.20 0.60 N 24 5 CB A TYR 83 ? ? CG A TYR 83 ? ? CD1 A TYR 83 ? ? 125.09 121.00 4.09 0.60 N 25 6 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.26 120.30 5.96 0.50 N 26 6 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.55 120.30 4.25 0.50 N 27 6 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 126.68 120.30 6.38 0.50 N 28 6 CB A TYR 83 ? ? CG A TYR 83 ? ? CD2 A TYR 83 ? ? 116.76 121.00 -4.24 0.60 N 29 6 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 124.93 120.30 4.63 0.50 N 30 6 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 125.28 120.30 4.98 0.50 N 31 7 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 126.43 120.30 6.13 0.50 N 32 7 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 116.71 120.30 -3.59 0.50 N 33 7 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 123.85 120.30 3.55 0.50 N 34 8 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 127.69 120.30 7.39 0.50 N 35 8 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.76 120.30 3.46 0.50 N 36 9 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 124.68 120.30 4.38 0.50 N 37 9 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 126.81 120.30 6.51 0.50 N 38 9 NH1 A ARG 92 ? ? CZ A ARG 92 ? ? NH2 A ARG 92 ? ? 112.61 119.40 -6.79 1.10 N 39 9 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 127.64 120.30 7.34 0.50 N 40 10 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.21 120.30 3.91 0.50 N 41 10 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH2 A ARG 85 ? ? 116.76 120.30 -3.54 0.50 N 42 10 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 125.19 120.30 4.89 0.50 N 43 11 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.94 120.30 6.64 0.50 N 44 11 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.13 120.30 3.83 0.50 N 45 11 CB A TYR 83 ? ? CG A TYR 83 ? ? CD2 A TYR 83 ? ? 115.54 121.00 -5.46 0.60 N 46 11 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 123.81 120.30 3.51 0.50 N 47 12 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.24 120.30 5.94 0.50 N 48 12 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.36 120.30 4.06 0.50 N 49 12 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.41 120.30 3.11 0.50 N 50 12 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.43 120.30 4.13 0.50 N 51 13 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 125.52 120.30 5.22 0.50 N 52 13 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.58 120.30 3.28 0.50 N 53 13 CB A PHE 59 ? ? CG A PHE 59 ? ? CD2 A PHE 59 ? ? 116.15 120.80 -4.65 0.70 N 54 13 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 123.86 120.30 3.56 0.50 N 55 14 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.86 120.30 3.56 0.50 N 56 14 NH1 A ARG 92 ? ? CZ A ARG 92 ? ? NH2 A ARG 92 ? ? 112.21 119.40 -7.19 1.10 N 57 14 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 126.04 120.30 5.74 0.50 N 58 15 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.34 120.30 6.04 0.50 N 59 15 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.65 120.30 3.35 0.50 N 60 15 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 124.20 120.30 3.90 0.50 N 61 15 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 116.63 120.30 -3.67 0.50 N 62 15 CB A PHE 64 ? ? CG A PHE 64 ? ? CD2 A PHE 64 ? ? 115.67 120.80 -5.13 0.70 N 63 15 CB A TYR 83 ? ? CG A TYR 83 ? ? CD2 A TYR 83 ? ? 115.82 121.00 -5.18 0.60 N 64 15 CB A TYR 83 ? ? CG A TYR 83 ? ? CD1 A TYR 83 ? ? 125.28 121.00 4.28 0.60 N 65 15 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.53 120.30 4.23 0.50 N 66 15 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH2 A ARG 92 ? ? 116.37 120.30 -3.93 0.50 N 67 16 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.31 120.30 3.01 0.50 N 68 16 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 125.30 120.30 5.00 0.50 N 69 16 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 125.26 120.30 4.96 0.50 N 70 17 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.93 120.30 6.63 0.50 N 71 17 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH2 A ARG 7 ? ? 116.95 120.30 -3.35 0.50 N 72 17 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 125.93 120.30 5.63 0.50 N 73 17 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 124.44 120.30 4.14 0.50 N 74 17 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 124.37 120.30 4.07 0.50 N 75 18 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 126.36 120.30 6.06 0.50 N 76 18 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 116.55 120.30 -3.75 0.50 N 77 18 CB A TYR 83 ? ? CG A TYR 83 ? ? CD2 A TYR 83 ? ? 116.95 121.00 -4.05 0.60 N 78 18 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 125.28 120.30 4.98 0.50 N 79 18 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 126.41 120.30 6.11 0.50 N 80 19 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 128.16 120.30 7.86 0.50 N 81 19 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 125.91 120.30 5.61 0.50 N 82 20 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.75 120.30 3.45 0.50 N 83 20 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.65 120.30 3.35 0.50 N 84 20 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.93 120.30 3.63 0.50 N 85 20 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 117.29 120.30 -3.01 0.50 N 86 20 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 124.56 120.30 4.26 0.50 N 87 20 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.42 120.30 4.12 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 13 ? ? -161.11 -61.15 2 1 GLU A 14 ? ? 51.33 7.82 3 1 LYS A 50 ? ? -160.91 105.12 4 1 ASP A 51 ? ? -53.10 173.32 5 1 LYS A 65 ? ? -94.68 58.34 6 1 VAL A 70 ? ? 73.52 119.14 7 1 LEU A 77 ? ? -89.14 -85.13 8 1 ASN A 78 ? ? 26.81 76.85 9 1 LYS A 81 ? ? -176.73 -176.80 10 1 LEU A 82 ? ? -141.16 -11.69 11 2 PHE A 4 ? ? -130.11 -40.61 12 2 ASP A 51 ? ? -54.48 171.99 13 2 VAL A 68 ? ? -85.34 32.52 14 2 PRO A 71 ? ? -106.75 57.82 15 2 MET A 74 ? ? -59.07 -8.63 16 2 LEU A 77 ? ? -98.29 -92.39 17 2 ASN A 78 ? ? 32.89 69.92 18 2 SER A 93 ? ? -94.42 30.28 19 3 GLU A 3 ? ? 68.16 135.20 20 3 GLU A 5 ? ? -107.33 46.39 21 3 ALA A 40 ? ? -87.60 31.40 22 3 PRO A 42 ? ? -49.68 101.55 23 3 ASP A 51 ? ? -57.25 172.64 24 3 LEU A 77 ? ? -120.64 -92.75 25 3 ASN A 78 ? ? 26.24 74.75 26 3 LYS A 81 ? ? -171.31 -173.23 27 3 LEU A 82 ? ? -143.33 -39.05 28 3 SER A 95 ? ? -93.32 52.54 29 4 PHE A 4 ? ? -142.10 -37.44 30 4 ARG A 8 ? ? -140.23 51.63 31 4 PRO A 56 ? ? -66.53 15.81 32 4 LEU A 77 ? ? -97.13 -83.60 33 4 ASN A 78 ? ? 24.19 66.41 34 5 GLN A 9 ? ? -78.23 -78.05 35 5 GLN A 10 ? ? 52.03 -30.76 36 5 PRO A 56 ? ? -67.52 10.04 37 5 VAL A 70 ? ? 36.65 66.67 38 5 LEU A 77 ? ? -98.31 -94.58 39 5 ASN A 78 ? ? 21.84 79.35 40 5 LEU A 82 ? ? -136.31 -44.35 41 6 PHE A 4 ? ? -138.16 -47.36 42 6 ASP A 51 ? ? -54.04 174.59 43 6 PRO A 56 ? ? -74.61 22.25 44 6 LEU A 77 ? ? -100.80 -106.99 45 6 ASN A 78 ? ? 42.24 70.69 46 6 ARG A 92 ? ? -91.54 58.76 47 7 LEU A 12 ? ? 46.01 -4.49 48 7 ASP A 51 ? ? -49.20 164.20 49 7 PRO A 56 ? ? -67.26 14.83 50 7 LYS A 57 ? ? 55.27 18.06 51 7 VAL A 70 ? ? 61.98 76.70 52 7 PRO A 71 ? ? -38.09 125.79 53 7 LEU A 77 ? ? -111.80 -96.77 54 7 ASN A 78 ? ? 29.97 66.37 55 7 SER A 95 ? ? 35.10 53.48 56 8 ARG A 8 ? ? -168.43 -17.55 57 8 GLN A 10 ? ? -78.31 22.72 58 8 ASP A 16 ? ? -118.23 59.28 59 8 ARG A 17 ? ? 57.32 7.12 60 8 LEU A 77 ? ? -88.69 -94.92 61 8 ASN A 78 ? ? 30.32 78.04 62 8 LEU A 82 ? ? -131.37 -31.85 63 9 ALA A 13 ? ? -142.79 -14.68 64 9 ASP A 16 ? ? -148.21 -45.47 65 9 PRO A 42 ? ? -61.32 99.82 66 9 SER A 69 ? ? -76.53 -81.53 67 9 LEU A 77 ? ? -87.88 -86.42 68 9 ASN A 78 ? ? 37.57 64.56 69 9 PHE A 91 ? ? 64.32 130.19 70 9 ARG A 92 ? ? -107.07 -63.24 71 9 HIS A 97 ? ? -172.34 134.71 72 9 ALA A 98 ? ? 78.67 166.66 73 9 GLN A 100 ? ? -135.71 -47.28 74 10 GLU A 3 ? ? 67.07 175.76 75 10 GLU A 5 ? ? -93.18 37.48 76 10 GLN A 10 ? ? -68.59 12.19 77 10 ALA A 40 ? ? -84.77 30.95 78 10 LEU A 77 ? ? -124.81 -86.45 79 10 ASN A 78 ? ? 23.03 71.67 80 10 TYR A 83 ? ? -93.57 -67.00 81 10 GLN A 100 ? ? -80.50 -73.93 82 11 ALA A 11 ? ? -170.82 -176.53 83 11 ARG A 17 ? ? 61.03 -14.66 84 11 ASN A 23 ? ? 71.39 31.22 85 11 PRO A 56 ? ? -69.21 12.16 86 11 HIS A 66 ? ? -150.97 -7.57 87 11 GLU A 67 ? ? -79.98 38.12 88 11 SER A 69 ? ? 69.74 -8.42 89 11 LEU A 77 ? ? -107.96 -88.34 90 11 ASN A 78 ? ? 27.01 71.11 91 11 ALA A 98 ? ? 68.89 153.73 92 11 GLN A 100 ? ? -151.49 -29.68 93 12 GLU A 5 ? ? -80.76 31.37 94 12 ARG A 7 ? ? -68.45 95.88 95 12 GLN A 10 ? ? -34.89 -28.06 96 12 LEU A 12 ? ? 59.30 4.19 97 12 HIS A 66 ? ? 37.90 56.45 98 12 VAL A 70 ? ? 70.04 107.35 99 12 LEU A 77 ? ? -105.15 -97.14 100 12 ASN A 78 ? ? 39.55 57.57 101 13 PHE A 4 ? ? -148.85 -25.74 102 13 LYS A 50 ? ? -160.58 118.56 103 13 PRO A 56 ? ? -66.53 12.51 104 13 SER A 69 ? ? -83.06 31.37 105 13 VAL A 70 ? ? -118.65 55.18 106 13 LEU A 77 ? ? -113.30 -84.25 107 13 ASN A 78 ? ? 23.70 59.85 108 13 TYR A 83 ? ? -129.27 -85.56 109 14 PRO A 56 ? ? -66.25 12.11 110 14 VAL A 68 ? ? -68.30 27.56 111 14 LEU A 77 ? ? -109.54 -92.85 112 14 ASN A 78 ? ? 37.75 52.23 113 15 PHE A 4 ? ? -159.79 -15.06 114 15 GLN A 10 ? ? -73.91 -77.11 115 15 ALA A 13 ? ? -148.88 -50.53 116 15 GLU A 14 ? ? 57.13 -14.34 117 15 ALA A 40 ? ? -96.88 36.52 118 15 ASP A 51 ? ? -43.45 164.52 119 15 PRO A 56 ? ? -68.81 14.27 120 15 HIS A 66 ? ? 56.84 18.07 121 15 VAL A 70 ? ? 31.68 59.68 122 15 LEU A 77 ? ? -111.14 -84.28 123 15 ASN A 78 ? ? 17.27 70.01 124 15 SER A 95 ? ? -145.04 -22.27 125 16 ARG A 8 ? ? -158.15 -28.47 126 16 GLN A 9 ? ? -152.79 -36.51 127 16 ARG A 17 ? ? 52.62 11.98 128 16 PRO A 56 ? ? -68.17 12.44 129 16 LEU A 77 ? ? -91.96 -92.32 130 16 ASN A 78 ? ? 27.23 70.70 131 16 SER A 96 ? ? 53.93 13.43 132 17 PHE A 4 ? ? -130.02 -42.98 133 17 ALA A 11 ? ? -161.33 -154.08 134 17 ARG A 17 ? ? 48.51 20.92 135 17 PRO A 56 ? ? -67.99 19.67 136 17 HIS A 66 ? ? -144.37 -6.93 137 17 GLU A 67 ? ? -79.12 40.21 138 17 SER A 69 ? ? 68.77 -28.45 139 17 LEU A 77 ? ? -107.68 -97.68 140 17 ASN A 78 ? ? 37.83 59.13 141 17 SER A 93 ? ? -57.48 99.59 142 17 ALA A 98 ? ? 70.30 152.62 143 18 GLU A 3 ? ? 58.37 16.91 144 18 ALA A 13 ? ? -148.01 -4.96 145 18 ASP A 16 ? ? -157.39 -23.34 146 18 PRO A 56 ? ? -67.89 9.61 147 18 PHE A 64 ? ? -154.98 -18.32 148 18 LEU A 77 ? ? -99.71 -89.66 149 18 PHE A 91 ? ? 77.53 157.01 150 18 ARG A 92 ? ? -147.58 -68.20 151 18 ALA A 98 ? ? 58.72 154.10 152 19 LYS A 50 ? ? -160.74 119.38 153 19 ASP A 51 ? ? -56.81 173.28 154 19 PRO A 71 ? ? -82.87 48.63 155 19 LEU A 77 ? ? -113.30 -82.11 156 19 ASN A 78 ? ? 19.99 70.52 157 19 LEU A 82 ? ? -140.19 22.95 158 19 TYR A 83 ? ? -149.47 -49.66 159 20 SER A 2 ? ? -167.37 48.77 160 20 PHE A 4 ? ? -142.26 -39.53 161 20 GLU A 5 ? ? -112.44 60.86 162 20 ALA A 13 ? ? 46.16 2.32 163 20 PRO A 42 ? ? -50.74 101.07 164 20 ASP A 51 ? ? -55.72 175.76 165 20 PRO A 56 ? ? -69.38 8.48 166 20 LYS A 57 ? ? 56.76 18.32 167 20 LEU A 77 ? ? -113.79 -86.02 168 20 ASN A 78 ? ? 26.82 59.48 169 20 LEU A 82 ? ? -140.15 -22.32 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 64 ? ? 0.085 'SIDE CHAIN' 2 1 TYR A 83 ? ? 0.062 'SIDE CHAIN' 3 1 ARG A 85 ? ? 0.077 'SIDE CHAIN' 4 2 ARG A 8 ? ? 0.104 'SIDE CHAIN' 5 2 ARG A 85 ? ? 0.112 'SIDE CHAIN' 6 3 ARG A 17 ? ? 0.098 'SIDE CHAIN' 7 3 TYR A 72 ? ? 0.084 'SIDE CHAIN' 8 5 PHE A 64 ? ? 0.079 'SIDE CHAIN' 9 5 ARG A 85 ? ? 0.076 'SIDE CHAIN' 10 6 ARG A 92 ? ? 0.078 'SIDE CHAIN' 11 8 TYR A 83 ? ? 0.090 'SIDE CHAIN' 12 9 ARG A 92 ? ? 0.141 'SIDE CHAIN' 13 10 ARG A 17 ? ? 0.093 'SIDE CHAIN' 14 11 PHE A 37 ? ? 0.082 'SIDE CHAIN' 15 11 TYR A 72 ? ? 0.083 'SIDE CHAIN' 16 11 ARG A 92 ? ? 0.080 'SIDE CHAIN' 17 13 ARG A 7 ? ? 0.103 'SIDE CHAIN' 18 13 PHE A 61 ? ? 0.093 'SIDE CHAIN' 19 13 TYR A 83 ? ? 0.095 'SIDE CHAIN' 20 14 ARG A 8 ? ? 0.106 'SIDE CHAIN' 21 14 ARG A 17 ? ? 0.088 'SIDE CHAIN' 22 15 ARG A 7 ? ? 0.093 'SIDE CHAIN' 23 15 ARG A 17 ? ? 0.116 'SIDE CHAIN' 24 15 PHE A 20 ? ? 0.098 'SIDE CHAIN' 25 16 ARG A 85 ? ? 0.109 'SIDE CHAIN' 26 16 ARG A 92 ? ? 0.100 'SIDE CHAIN' 27 17 TYR A 83 ? ? 0.072 'SIDE CHAIN' 28 18 TYR A 72 ? ? 0.082 'SIDE CHAIN' 29 19 ARG A 7 ? ? 0.095 'SIDE CHAIN' 30 19 ARG A 8 ? ? 0.117 'SIDE CHAIN' #