data_2M8W # _entry.id 2M8W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M8W pdb_00002m8w 10.2210/pdb2m8w/pdb RCSB RCSB103356 ? ? BMRB 5844 ? ? WWPDB D_1000103356 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5844 BMRB 'NMR chemical shift assignments' unspecified 2M6Q PDB 'CNS-water refined structures' unspecified NESG-ZR18 TargetTrack . unspecified 1PQX PDB 'Original AutoStructure structure determination' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M8W _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-05-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mao, B.' 1 'Tejero, R.T.' 2 'Aramini, J.M.' 3 'Snyder, D.A.' 4 'Montelione, G.T.' 5 'Northeast Structural Genomics Consortium (NESG)' 6 # _citation.id primary _citation.title 'PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 56 _citation.page_first 337 _citation.page_last 351 _citation.year 2013 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23897031 _citation.pdbx_database_id_DOI 10.1007/s10858-013-9753-7 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tejero, R.' 1 ? primary 'Snyder, D.' 2 ? primary 'Mao, B.' 3 ? primary 'Aramini, J.M.' 4 ? primary 'Montelione, G.T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 10487.755 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name SAV1430 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEA VFELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEA VFELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-ZR18 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ILE n 1 4 ILE n 1 5 SER n 1 6 ILE n 1 7 SER n 1 8 GLU n 1 9 THR n 1 10 PRO n 1 11 ASN n 1 12 HIS n 1 13 ASN n 1 14 THR n 1 15 MET n 1 16 LYS n 1 17 ILE n 1 18 THR n 1 19 LEU n 1 20 SER n 1 21 GLU n 1 22 SER n 1 23 ARG n 1 24 GLU n 1 25 GLY n 1 26 MET n 1 27 THR n 1 28 SER n 1 29 ASP n 1 30 THR n 1 31 TYR n 1 32 THR n 1 33 LYS n 1 34 VAL n 1 35 ASP n 1 36 ASP n 1 37 SER n 1 38 GLN n 1 39 PRO n 1 40 ALA n 1 41 PHE n 1 42 ILE n 1 43 ASN n 1 44 ASP n 1 45 ILE n 1 46 LEU n 1 47 LYS n 1 48 VAL n 1 49 GLU n 1 50 GLY n 1 51 VAL n 1 52 LYS n 1 53 SER n 1 54 ILE n 1 55 PHE n 1 56 HIS n 1 57 VAL n 1 58 MET n 1 59 ASP n 1 60 PHE n 1 61 ILE n 1 62 SER n 1 63 VAL n 1 64 ASP n 1 65 LYS n 1 66 GLU n 1 67 ASN n 1 68 ASP n 1 69 ALA n 1 70 ASN n 1 71 TRP n 1 72 GLU n 1 73 THR n 1 74 VAL n 1 75 LEU n 1 76 PRO n 1 77 LYS n 1 78 VAL n 1 79 GLU n 1 80 ALA n 1 81 VAL n 1 82 PHE n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 HIS n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SAV1430 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Mu50 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158878 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21MGK _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PET21 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ZR18-21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99U58_STAAM _struct_ref.pdbx_db_accession Q99U58 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEA VFE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M8W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99U58 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M8W LEU A 84 ? UNP Q99U58 ? ? 'expression tag' 84 1 1 2M8W GLU A 85 ? UNP Q99U58 ? ? 'expression tag' 85 2 1 2M8W HIS A 86 ? UNP Q99U58 ? ? 'expression tag' 86 3 1 2M8W HIS A 87 ? UNP Q99U58 ? ? 'expression tag' 87 4 1 2M8W HIS A 88 ? UNP Q99U58 ? ? 'expression tag' 88 5 1 2M8W HIS A 89 ? UNP Q99U58 ? ? 'expression tag' 89 6 1 2M8W HIS A 90 ? UNP Q99U58 ? ? 'expression tag' 90 7 1 2M8W HIS A 91 ? UNP Q99U58 ? ? 'expression tag' 91 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 'NH HSQC' 1 2 2 HNCO 1 3 2 HNCACB 1 4 2 HNCOCACB 1 7 2 'HCC(CO)NH-TOCSY' 1 8 2 'H(CCCO)NH-TOCSY' 1 9 2 HACACONH 1 10 2 HACANH 1 11 2 'CH HSQC' 1 12 2 HCCH-COSY 1 13 2 '13C EDITED NOESY' 1 14 2 'HBCBCGCDHD RD' 1 15 2 'AROMATICTOCSY RD' 1 16 1 hetNOE 1 17 1 HNHA 1 18 2 '15N EDITED NOESY' 1 19 1 'CH HSQC high res.' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.3 mM [U-100% 15N; U-5% 13C] ZR18, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02 % NaN3, 5 % D2O, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1.15 mM [U-100% 15N; U-100% 13C] ZR18, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02 % NaN3, 5 % D2O, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian 'UNITY Inova' 1 'Varian UNITY Inova' 600 Varian 'UNITY Inova' 2 'Varian UNITY Inova' # _pdbx_nmr_refine.entry_id 2M8W _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;Structures were calculated by Restrained CS-Rosetta method using NOE-based distance, dihedral angle, and hydrogen bond restraints from the original AutoStructure structure calculations ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2M8W _pdbx_nmr_details.text 'THE FIRST REPRESENTATIVE STRUCTURE IN THE ENSEMBLE IS THE MEDOID STRUCTURE.' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 10000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M8W _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M8W _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Tejero, Monleon, Celda, Powers and Montelione' 'data analysis' HYPER 3.2 1 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 2.1 2 Varian 'data collection' VNMR6.1C ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'raw spectral data processing' NMRPipe ? 4 Goddard 'spectral visualization' Sparky ? 5 'Zimmerman, Moseley, Kulikowski and Montelione' 'automated backbone assignments' AutoAssign ? 6 'Baran, Montelione' 'integrated spectral analysus software' SPINS ? 7 'Baran, Montelione' 'integrated spectral analysus software' SPINS ? 8 ? refinement Rosetta ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Structure refined using Restrained CS-Rosetta' _exptl.entry_id 2M8W _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M8W _struct.title ;Restrained CS-Rosetta Solution NMR Structure of Staphylococcus aureus protein SAV1430. Northeast Structural Genomics Target ZR18. Structure determination ; _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M8W _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 39 ? VAL A 48 ? PRO A 39 VAL A 48 1 ? 10 HELX_P HELX_P2 2 ASN A 70 ? HIS A 87 ? ASN A 70 HIS A 87 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 90 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 90 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 91 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 91 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 6 _struct_mon_prot_cis.pdbx_omega_angle 0.41 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 3 ? SER A 7 ? ILE A 3 SER A 7 A 2 THR A 14 ? LEU A 19 ? THR A 14 LEU A 19 A 3 PHE A 60 ? LYS A 65 ? PHE A 60 LYS A 65 A 4 VAL A 51 ? VAL A 57 ? VAL A 51 VAL A 57 A 5 ASP A 29 ? TYR A 31 ? ASP A 29 TYR A 31 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 4 O THR A 18 ? O THR A 18 A 2 3 N ILE A 17 ? N ILE A 17 O ILE A 61 ? O ILE A 61 A 3 4 O SER A 62 ? O SER A 62 N PHE A 55 ? N PHE A 55 A 4 5 O ILE A 54 ? O ILE A 54 N TYR A 31 ? N TYR A 31 # _atom_sites.entry_id 2M8W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 HIS 91 91 91 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-21 2 'Structure model' 1 1 2014-02-05 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ZR18-1 1.3 ? mM '[U-100% 15N; U-5% 13C]' 1 MES-2 20 ? mM ? 1 NaCl-3 100 ? mM ? 1 CaCl2-4 5 ? mM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.02 ? % ? 1 D2O-7 5 ? % ? 1 ZR18-8 1.15 ? mM '[U-100% 15N; U-100% 13C]' 2 MES-9 20 ? mM ? 2 NaCl-10 100 ? mM ? 2 CaCl2-11 5 ? mM ? 2 DTT-12 10 ? mM ? 2 NaN3-13 0.02 ? % ? 2 D2O-14 5 ? % ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 22 ? ? -117.88 -164.88 2 1 MET A 58 ? ? 55.03 -106.44 3 2 MET A 58 ? ? 59.63 -120.35 4 2 HIS A 88 ? ? -105.17 64.98 5 3 MET A 58 ? ? 49.00 -129.41 6 3 HIS A 89 ? ? 64.95 -155.01 7 3 HIS A 90 ? ? -170.16 -177.39 8 4 MET A 58 ? ? 51.99 -131.52 9 5 ARG A 23 ? ? -58.74 171.15 10 5 MET A 26 ? ? -99.11 41.60 11 5 MET A 58 ? ? 64.79 -124.98 12 6 ARG A 23 ? ? -37.54 133.96 13 6 MET A 58 ? ? 59.18 -125.06 14 7 MET A 58 ? ? 62.68 -124.89 15 8 MET A 26 ? ? -92.59 42.58 16 8 MET A 58 ? ? 61.64 -124.85 17 9 MET A 26 ? ? -93.78 41.28 18 9 MET A 58 ? ? 54.51 -105.05 19 9 HIS A 90 ? ? 64.85 -155.01 20 10 MET A 26 ? ? -94.26 42.46 21 10 MET A 58 ? ? 57.25 -123.11 22 11 SER A 22 ? ? -89.98 -159.95 23 11 MET A 58 ? ? 59.15 -123.90 24 12 MET A 58 ? ? 58.03 -122.64 25 12 HIS A 86 ? ? -104.98 65.04 26 13 MET A 58 ? ? 55.01 -105.02 27 13 ASP A 59 ? ? -141.71 33.61 28 14 MET A 26 ? ? -97.67 42.12 29 14 MET A 58 ? ? 55.18 -116.89 30 15 MET A 58 ? ? 54.40 -104.99 31 15 GLU A 83 ? ? -96.69 41.75 32 16 THR A 32 ? ? -125.10 -71.93 33 16 MET A 58 ? ? 64.75 -121.94 34 16 PHE A 82 ? ? -91.12 37.23 35 17 SER A 22 ? ? -122.61 -167.10 36 17 ARG A 23 ? ? -58.23 173.47 37 17 MET A 26 ? ? -98.75 40.09 38 17 MET A 58 ? ? 54.59 -105.11 39 18 MET A 26 ? ? -91.87 55.16 40 18 MET A 58 ? ? 61.82 -105.03 41 18 ASP A 59 ? ? -141.14 31.43 42 19 THR A 27 ? ? -119.22 -163.10 43 19 MET A 58 ? ? 58.31 -118.77 44 20 ASN A 13 ? ? 80.38 12.04 45 20 MET A 58 ? ? 54.93 -110.03 #