data_2M9R # _entry.id 2M9R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M9R RCSB RCSB103387 BMRB 19309 WWPDB D_1000103387 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19309 BMRB unspecified . 2M9S PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M9R _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Monti, J.' 1 'Richard, T.' 2 # _citation.id primary _citation.title ;3D NMR structure of a complex between the amyloid beta peptide (1-40) and the polyphenol epsilon-viniferin glucoside: Implications in Alzheimer's disease. ; _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1830 _citation.page_first 5068 _citation.page_last 5074 _citation.year 2013 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23830862 _citation.pdbx_database_id_DOI 10.1016/j.bbagen.2013.06.031 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Richard, T.' 1 primary 'Papastamoulis, Y.' 2 primary 'Pierre, W.T.' 3 primary 'Monti, J.P.' 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Amyloid beta A4 protein' 4335.852 1 ? ? 'UNP residues 672-711' ? 2 non-polymer syn ;(2S,3S)-3-(3,5-dihydroxyphenyl)-2-(4-hydroxyphenyl)-4-[(E)-2-(4-hydroxyphenyl)ethenyl]-2,3-dihydro-1-benzofuran-6-yl beta-D-glucopyranoside ; 616.611 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_seq_one_letter_code_can DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 GLU n 1 4 PHE n 1 5 ARG n 1 6 HIS n 1 7 ASP n 1 8 SER n 1 9 GLY n 1 10 TYR n 1 11 GLU n 1 12 VAL n 1 13 HIS n 1 14 HIS n 1 15 GLN n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 PHE n 1 20 PHE n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 VAL n 1 25 GLY n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 ILE n 1 33 GLY n 1 34 LEU n 1 35 MET n 1 36 VAL n 1 37 GLY n 1 38 GLY n 1 39 VAL n 1 40 VAL n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4_HUMAN _struct_ref.pdbx_db_accession P05067 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _struct_ref.pdbx_align_begin 672 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M9R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05067 _struct_ref_seq.db_align_beg 672 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 711 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 23Y non-polymer . ;(2S,3S)-3-(3,5-dihydroxyphenyl)-2-(4-hydroxyphenyl)-4-[(E)-2-(4-hydroxyphenyl)ethenyl]-2,3-dihydro-1-benzofuran-6-yl beta-D-glucopyranoside ; 'POLYPHENOL EPSILON-VINIFERIN GLUCOSIDE' 'C34 H32 O11' 616.611 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM amyloid peptide, 100% DMSO-d6' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '100% DMSO-d6' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M9R _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THIS FAMILY REPRESENTS THE TURN IN THE N-TERMINUS GLY9-LYS16 OBTAINED BY AN INDEPENDENT SUPERIMPOSITION RELATIVE TO THE TURN IN THE C-TERMINUS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M9R _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M9R _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Accelrys Software Inc.' 'structure solution' InsightII ? 1 'Accelrys Software Inc.' refinement InsightII ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M9R _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M9R _struct.title '3D NMR structure of a complex between the amyloid beta peptide (1-40) and the polyphenol epsilon-viniferin glucoside' _struct.pdbx_descriptor 'Amyloid beta A4 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M9R _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' _struct_keywords.text 'amyloid peptide, PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE 23Y A 101' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE 23Y A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 TYR A 10 ? TYR A 10 . ? 1_555 ? 2 AC1 3 GLN A 15 ? GLN A 15 . ? 1_555 ? 3 AC1 3 PHE A 19 ? PHE A 19 . ? 1_555 ? 4 AC2 2 LYS A 28 ? LYS A 28 . ? 1_555 ? 5 AC2 2 GLY A 29 ? GLY A 29 . ? 1_555 ? # _atom_sites.entry_id 2M9R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 23Y 1 101 1 23Y EVG A . C 2 23Y 1 102 2 23Y EVG A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-09-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_nmr_exptl_sample.component 'amyloid peptide-1' _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 23 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HOC4 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 23Y _pdbx_validate_close_contact.auth_seq_id_2 102 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.48 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 3 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 13 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 13 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.408 _pdbx_validate_rmsd_bond.bond_target_value 1.354 _pdbx_validate_rmsd_bond.bond_deviation 0.054 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.009 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.93 120.30 3.63 0.50 N 2 1 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.10 111.50 8.60 1.30 N 3 1 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.04 111.50 8.54 1.30 N 4 1 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.14 111.50 8.64 1.30 N 5 2 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.95 120.30 3.65 0.50 N 6 2 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.28 111.50 8.78 1.30 N 7 2 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.17 111.50 8.67 1.30 N 8 2 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.15 111.50 8.65 1.30 N 9 3 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.93 120.30 3.63 0.50 N 10 3 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.12 111.50 8.62 1.30 N 11 3 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 119.98 111.50 8.48 1.30 N 12 3 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.14 111.50 8.64 1.30 N 13 4 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.04 120.30 3.74 0.50 N 14 4 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.15 111.50 8.65 1.30 N 15 4 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 119.80 111.50 8.30 1.30 N 16 4 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.06 111.50 8.56 1.30 N 17 5 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.01 120.30 3.71 0.50 N 18 5 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.16 111.50 8.66 1.30 N 19 5 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.16 111.50 8.66 1.30 N 20 5 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.13 111.50 8.63 1.30 N 21 6 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.01 120.30 3.71 0.50 N 22 6 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.09 111.50 8.59 1.30 N 23 6 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.16 111.50 8.66 1.30 N 24 6 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.33 111.50 8.83 1.30 N 25 7 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.01 120.30 3.71 0.50 N 26 7 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.18 111.50 8.68 1.30 N 27 7 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.10 111.50 8.60 1.30 N 28 7 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.10 111.50 8.60 1.30 N 29 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.01 120.30 3.71 0.50 N 30 8 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.09 111.50 8.59 1.30 N 31 8 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.07 111.50 8.57 1.30 N 32 8 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.10 111.50 8.60 1.30 N 33 9 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.78 120.30 3.48 0.50 N 34 9 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.08 111.50 8.58 1.30 N 35 9 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.01 111.50 8.51 1.30 N 36 9 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.01 111.50 8.51 1.30 N 37 10 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.16 120.30 3.86 0.50 N 38 10 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.05 111.50 8.55 1.30 N 39 10 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.08 111.50 8.58 1.30 N 40 10 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.12 111.50 8.62 1.30 N 41 11 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.17 120.30 3.87 0.50 N 42 11 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.06 111.50 8.56 1.30 N 43 11 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.07 111.50 8.57 1.30 N 44 11 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.08 111.50 8.58 1.30 N 45 12 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.98 120.30 3.68 0.50 N 46 12 ND1 A HIS 6 ? ? CE1 A HIS 6 ? ? NE2 A HIS 6 ? ? 120.05 111.50 8.55 1.30 N 47 12 ND1 A HIS 13 ? ? CE1 A HIS 13 ? ? NE2 A HIS 13 ? ? 120.12 111.50 8.62 1.30 N 48 12 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.13 111.50 8.63 1.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? -133.25 -55.01 2 2 LEU A 17 ? ? -173.11 140.94 3 2 ILE A 32 ? ? -138.20 -40.64 4 2 VAL A 39 ? ? -130.04 -81.75 5 3 ASP A 7 ? ? -127.46 -66.59 6 3 LEU A 17 ? ? -62.38 96.74 7 3 ASP A 23 ? ? -170.46 96.69 8 3 ASN A 27 ? ? -168.43 -50.61 9 3 ILE A 32 ? ? -140.75 -57.22 10 3 VAL A 39 ? ? -133.26 -63.73 11 4 ALA A 2 ? ? -123.09 -52.01 12 5 LEU A 17 ? ? -179.81 145.21 13 6 ASP A 7 ? ? -134.19 -56.09 14 6 VAL A 18 ? ? -59.60 104.06 15 6 ASP A 23 ? ? -170.93 98.72 16 8 LEU A 17 ? ? -170.49 131.77 17 8 ASP A 23 ? ? -142.53 -41.58 18 9 VAL A 18 ? ? -67.67 95.81 19 9 ASN A 27 ? ? -67.45 98.10 20 10 LEU A 17 ? ? -179.71 146.27 21 11 LEU A 17 ? ? -179.25 145.07 22 12 ASP A 23 ? ? -160.90 98.19 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;(2S,3S)-3-(3,5-dihydroxyphenyl)-2-(4-hydroxyphenyl)-4-[(E)-2-(4-hydroxyphenyl)ethenyl]-2,3-dihydro-1-benzofuran-6-yl beta-D-glucopyranoside ; _pdbx_entity_nonpoly.comp_id 23Y #