data_2M9W # _entry.id 2M9W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M9W pdb_00002m9w 10.2210/pdb2m9w/pdb RCSB RCSB103392 ? ? BMRB 19312 ? ? WWPDB D_1000103392 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19312 BMRB unspecified . NESG-HR4783B TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M9W _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, X.' 1 'Eletsky, A.' 2 'Lee, D.' 3 'Kohn, E.' 4 'Janjua, H.' 5 'Xiao, R.' 6 'Acton, T.B.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Szyperski, T.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title ;Solution NMR Structure of a Transcription Factor GATA-4 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR4783B ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, X.' 1 ? primary 'Eletsky, A.' 2 ? primary 'Lee, D.' 3 ? primary 'Kohn, E.' 4 ? primary 'Janjua, H.' 5 ? primary 'Xiao, R.' 6 ? primary 'Acton, T.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Montelione, G.T.' 9 ? primary 'Szyperski, T.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription factor GATA-4' 7073.291 1 ? ? 'GATA-type 2 zinc finger residues 262-321' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GATA-binding factor 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SHMSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK _entity_poly.pdbx_seq_one_letter_code_can SHMSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR4783B # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 HIS n 1 3 MET n 1 4 SER n 1 5 ALA n 1 6 SER n 1 7 ARG n 1 8 ARG n 1 9 VAL n 1 10 GLY n 1 11 LEU n 1 12 SER n 1 13 CYS n 1 14 ALA n 1 15 ASN n 1 16 CYS n 1 17 GLN n 1 18 THR n 1 19 THR n 1 20 THR n 1 21 THR n 1 22 THR n 1 23 LEU n 1 24 TRP n 1 25 ARG n 1 26 ARG n 1 27 ASN n 1 28 ALA n 1 29 GLU n 1 30 GLY n 1 31 GLU n 1 32 PRO n 1 33 VAL n 1 34 CYS n 1 35 ASN n 1 36 ALA n 1 37 CYS n 1 38 GLY n 1 39 LEU n 1 40 TYR n 1 41 MET n 1 42 LYS n 1 43 LEU n 1 44 HIS n 1 45 GLY n 1 46 VAL n 1 47 PRO n 1 48 ARG n 1 49 PRO n 1 50 LEU n 1 51 ALA n 1 52 MET n 1 53 ARG n 1 54 LYS n 1 55 GLU n 1 56 GLY n 1 57 ILE n 1 58 GLN n 1 59 THR n 1 60 ARG n 1 61 LYS n 1 62 ARG n 1 63 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GATA4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15Nano6HT_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GATA4_HUMAN _struct_ref.pdbx_db_accession P43694 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK _struct_ref.pdbx_align_begin 262 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M9W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P43694 _struct_ref_seq.db_align_beg 262 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 63 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M9W SER A 1 ? UNP P43694 ? ? 'expression tag' 1 1 1 2M9W HIS A 2 ? UNP P43694 ? ? 'expression tag' 2 2 1 2M9W MET A 3 ? UNP P43694 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D CT 1H-13C HSQC ali' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '2D CT 1H-13C HSQC aro' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '3D CCH-TOCSY' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '2D 1H-15N HSQC_His' 1 11 1 '2D 1H-15N HSQC_wide' 1 12 1 '3D (H)CCH-COSY ali' 1 13 2 '2D 1H-13C HSQC_methyl' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.378 mM [U-100% 13C; U-100% 15N] HR4783B.009, 100 mM sodium chloride, 5 mM DTT, 10 mM Tris-HCl, 50 uM DSS, 0.02 % sodium azide, 50 uM ZINC ION, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.156 mM [U-5% 13C; U-100% 15N] HR4783B.009, 100 mM sodium chloride, 5 mM DTT, 10 mM Tris-HCl, 50 uM DSS, 0.02 % sodium azide, 50 uM ZINC ION, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 750 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2M9W _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structure determination was performed by runnning CYANA and ASDP in parallel using NOE-based constraints and phi and psi dihedral angle constraints from Talos+. Consensus peak assignments were selected and used in iterative refinement with CYANA. The 20 conformers out of 100 with the lowest target function were further refined by simulated annealing in explicit water bath using the program CNS with PARAM19 force field. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M9W _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M9W _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.3 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.3 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS 1.3 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.3.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.3.1 10 'Bartels et al.' 'data analysis' XEASY ? 11 'Bartels et al.' 'peak picking' XEASY ? 12 'Bartels et al.' 'chemical shift assignment' XEASY ? 13 Varian collection VnmrJ 2.3.1 14 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 15 'Bhattacharya, Montelione' 'structure validation' PSVS 1.4 16 Guntert 'data analysis' PROSA ? 17 'Wishart and Sykes' 'data analysis' CSI ? 18 'Keller and Wuthrich' 'data analysis' CARA 1.8.4 19 'Keller and Wuthrich' 'peak picking' CARA 1.8.4 20 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 21 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M9W _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M9W _struct.title ;Solution NMR Structure of Transcription Factor GATA-4 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR4783B ; _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M9W _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 35 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 44 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 35 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 44 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 101 1_555 ? ? ? ? ? ? ? 1.934 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 101 1_555 ? ? ? ? ? ? ? 1.858 ? ? metalc3 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 101 1_555 ? ? ? ? ? ? ? 1.816 ? ? metalc4 metalc ? ? A CYS 37 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 37 A ZN 101 1_555 ? ? ? ? ? ? ? 1.922 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 24 ? ARG A 26 ? TRP A 24 ARG A 26 A 2 PRO A 32 ? CYS A 34 ? PRO A 32 CYS A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 25 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 25 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 2 AC1 4 CYS A 16 ? CYS A 16 . ? 1_555 ? 3 AC1 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 4 AC1 4 CYS A 37 ? CYS A 37 . ? 1_555 ? # _atom_sites.entry_id 2M9W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LYS 63 63 63 LYS LYS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 125 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 100.2 ? 2 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 124.1 ? 3 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 111.4 ? 4 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 109.8 ? 5 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 106.7 ? 6 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 103.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-10 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_struct_conn_angle 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ref_seq_dif 7 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.value' 10 2 'Structure model' '_struct_conn.pdbx_dist_value' 11 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 2 'Structure model' '_struct_ref_seq_dif.details' 14 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 15 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 16 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR4783B.009-1 0.378 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-2' 100 ? mM ? 1 DTT-3 5 ? mM ? 1 Tris-HCl-4 10 ? mM ? 1 DSS-5 50 ? uM ? 1 'sodium azide-6' 0.02 ? % ? 1 'ZINC ION-7' 50 ? uM ? 1 HR4783B.009-8 0.156 ? mM '[U-5% 13C; U-100% 15N]' 2 'sodium chloride-9' 100 ? mM ? 2 DTT-10 5 ? mM ? 2 Tris-HCl-11 10 ? mM ? 2 DSS-12 50 ? uM ? 2 'sodium azide-13' 0.02 ? % ? 2 'ZINC ION-14' 50 ? uM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M9W _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 10 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 7 ? ? -53.26 99.72 2 1 LEU A 11 ? ? 65.14 -172.91 3 1 ASN A 15 ? ? -171.59 -68.13 4 1 GLN A 17 ? ? 68.73 -1.95 5 1 HIS A 44 ? ? -124.83 -71.51 6 1 LEU A 50 ? ? -113.38 -71.21 7 1 ALA A 51 ? ? -94.00 35.81 8 1 MET A 52 ? ? 69.08 173.47 9 1 ARG A 53 ? ? -80.53 44.66 10 1 GLU A 55 ? ? -91.71 44.09 11 2 ASN A 15 ? ? -172.34 -51.06 12 2 ASN A 27 ? ? -76.97 -168.95 13 2 LEU A 50 ? ? -91.23 -60.79 14 2 ALA A 51 ? ? -139.27 -50.36 15 2 MET A 52 ? ? -68.51 96.85 16 2 LYS A 54 ? ? -163.40 83.83 17 2 GLN A 58 ? ? 79.97 -44.76 18 2 ARG A 62 ? ? -97.26 40.75 19 3 ALA A 5 ? ? -90.43 52.56 20 3 SER A 6 ? ? -67.01 94.07 21 3 ASN A 15 ? ? -171.35 -56.45 22 3 ARG A 53 ? ? -48.99 97.70 23 3 ARG A 60 ? ? 67.45 110.79 24 4 LEU A 11 ? ? 69.26 170.73 25 4 GLU A 55 ? ? 60.50 -172.60 26 4 ILE A 57 ? ? 48.46 94.68 27 4 GLN A 58 ? ? -61.34 99.22 28 4 ARG A 62 ? ? 74.45 -54.35 29 5 ASN A 15 ? ? -103.03 -72.18 30 5 THR A 21 ? ? -170.87 141.98 31 6 HIS A 2 ? ? -164.75 53.47 32 6 CYS A 13 ? ? -55.14 103.63 33 6 ASN A 15 ? ? -94.16 -75.39 34 6 GLN A 17 ? ? 61.66 69.95 35 6 ARG A 48 ? ? -59.34 109.47 36 6 LYS A 54 ? ? -69.14 83.14 37 6 THR A 59 ? ? -63.78 94.79 38 6 ARG A 62 ? ? 63.69 100.92 39 7 ARG A 7 ? ? 55.60 72.21 40 7 ASN A 27 ? ? -71.17 -169.13 41 7 ILE A 57 ? ? 56.48 75.97 42 8 VAL A 9 ? ? 63.43 88.07 43 8 THR A 19 ? ? 67.63 -47.20 44 8 HIS A 44 ? ? -129.14 -71.20 45 8 LEU A 50 ? ? -100.07 -69.98 46 8 LYS A 61 ? ? -154.82 24.74 47 9 HIS A 2 ? ? -68.09 84.89 48 9 MET A 3 ? ? -161.49 114.96 49 9 SER A 6 ? ? -66.91 94.58 50 9 ASN A 15 ? ? -175.38 -67.41 51 9 ALA A 51 ? ? -173.81 -49.39 52 9 ARG A 53 ? ? -144.64 -46.74 53 9 LYS A 54 ? ? 60.68 73.92 54 9 GLU A 55 ? ? 74.00 135.42 55 9 ARG A 62 ? ? -64.66 93.15 56 10 ASN A 15 ? ? -170.40 -78.69 57 10 THR A 19 ? ? 63.34 -66.25 58 10 THR A 20 ? ? -68.50 85.71 59 10 PRO A 32 ? ? -69.75 96.99 60 10 ARG A 53 ? ? -145.05 -31.79 61 10 THR A 59 ? ? 64.89 80.48 62 11 ALA A 5 ? ? -64.10 93.29 63 11 LEU A 11 ? ? 67.63 173.47 64 11 ASN A 15 ? ? -97.98 -60.51 65 11 PRO A 32 ? ? -67.17 97.88 66 11 LEU A 43 ? ? -81.47 -74.79 67 12 HIS A 2 ? ? 62.84 169.69 68 12 SER A 4 ? ? -64.61 97.07 69 12 ALA A 5 ? ? -65.88 87.63 70 12 SER A 6 ? ? -151.82 76.90 71 12 ASN A 15 ? ? -172.25 -78.09 72 12 GLN A 17 ? ? 63.57 81.81 73 12 ASN A 27 ? ? -74.18 -169.02 74 12 ALA A 51 ? ? -144.50 -66.94 75 12 MET A 52 ? ? -109.75 67.82 76 12 GLU A 55 ? ? 63.02 -79.24 77 12 ILE A 57 ? ? 59.88 82.75 78 12 LYS A 61 ? ? 61.72 92.24 79 13 LEU A 11 ? ? -129.29 -166.17 80 13 GLN A 17 ? ? -16.47 84.34 81 13 THR A 19 ? ? 56.04 10.61 82 13 THR A 20 ? ? -174.14 143.58 83 13 LEU A 23 ? ? 69.16 98.71 84 13 LYS A 54 ? ? -165.09 117.05 85 13 THR A 59 ? ? -136.69 -135.73 86 13 ARG A 60 ? ? 69.11 -63.52 87 14 HIS A 2 ? ? 67.73 -87.86 88 14 MET A 3 ? ? 177.55 -170.85 89 14 ALA A 5 ? ? -63.14 94.09 90 14 ARG A 7 ? ? -94.35 40.07 91 14 ASN A 15 ? ? -174.25 -61.22 92 14 GLN A 17 ? ? 70.51 -8.23 93 14 PRO A 32 ? ? -69.04 91.99 94 14 LYS A 61 ? ? 69.44 126.73 95 15 ARG A 8 ? ? -66.10 97.28 96 15 ASN A 15 ? ? -97.92 -65.56 97 15 LYS A 54 ? ? -150.74 72.41 98 15 GLU A 55 ? ? 61.60 -90.93 99 16 MET A 3 ? ? -145.85 -37.03 100 16 ALA A 5 ? ? -92.83 56.07 101 16 ASN A 15 ? ? -92.40 -69.06 102 16 GLN A 17 ? ? 65.64 83.61 103 16 ARG A 53 ? ? 63.82 84.20 104 16 LYS A 54 ? ? -109.39 -120.88 105 16 ILE A 57 ? ? 71.14 123.49 106 16 ARG A 62 ? ? 64.21 74.45 107 17 SER A 4 ? ? -64.41 95.45 108 17 SER A 6 ? ? -61.61 86.96 109 17 ARG A 8 ? ? 60.00 77.96 110 17 LEU A 11 ? ? 67.17 159.68 111 17 ASN A 15 ? ? -90.37 -86.32 112 17 CYS A 16 ? ? -105.48 68.76 113 17 GLN A 17 ? ? -20.74 74.17 114 17 THR A 19 ? ? 59.66 9.76 115 17 LEU A 50 ? ? -94.51 -159.60 116 17 LYS A 54 ? ? 62.51 87.23 117 17 GLU A 55 ? ? 70.71 -70.65 118 17 ILE A 57 ? ? -69.00 88.64 119 18 MET A 3 ? ? -65.20 98.93 120 18 LEU A 11 ? ? -143.33 -157.65 121 18 ALA A 14 ? ? -87.21 49.01 122 18 ASN A 15 ? ? -161.98 -49.75 123 18 THR A 21 ? ? -171.39 -176.86 124 18 LEU A 23 ? ? 59.40 87.02 125 18 ALA A 51 ? ? 57.86 -84.94 126 19 ASN A 15 ? ? -175.18 -62.44 127 19 HIS A 44 ? ? -99.50 -71.59 128 19 ALA A 51 ? ? -66.45 93.08 129 19 GLU A 55 ? ? 69.85 98.54 130 19 ARG A 62 ? ? 70.97 99.99 131 20 VAL A 9 ? ? 63.14 86.16 132 20 ASN A 15 ? ? -163.03 -66.27 133 20 ALA A 51 ? ? 63.82 -81.76 134 20 MET A 52 ? ? 56.31 -72.94 135 20 ARG A 53 ? ? -79.92 37.37 136 20 LYS A 54 ? ? -40.63 80.38 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #