data_2M9Y # _entry.id 2M9Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M9Y pdb_00002m9y 10.2210/pdb2m9y/pdb RCSB RCSB103394 ? ? BMRB 19315 ? 10.13018/BMR19315 WWPDB D_1000103394 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-11-13 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_struct_conn_angle 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ref_seq_dif 7 2 'Structure model' struct_site 8 3 'Structure model' chem_comp_atom 9 3 'Structure model' chem_comp_bond 10 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 2 'Structure model' '_struct_ref_seq_dif.details' 27 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 2 'Structure model' '_struct_site.pdbx_auth_seq_id' 30 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M9Y _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19315 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mercier, P.' 1 'Spratt, D.E.' 2 'Shaw, G.S.' 3 # _citation.id primary _citation.title 'Structure of the HHARI catalytic domain shows glimpses of a HECT E3 ligase.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 8 _citation.page_first e74047 _citation.page_last e74047 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24058416 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0074047 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Spratt, D.E.' 1 ? primary 'Mercier, P.' 2 ? primary 'Shaw, G.S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase ARIH1' 8439.263 1 6.3.2.- C357S 'Catalytic Domain (UNP residues 325-396)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;H7-AP2, HHARI, Monocyte protein 6, MOP-6, Protein ariadne-1 homolog, ARI-1, UbcH7-binding protein, UbcM4-interacting protein, Ubiquitin-conjugating enzyme E2-binding protein 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSKKCDDDSETSNWIAANTKECPKCHVTIEKDGGSNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDD _entity_poly.pdbx_seq_one_letter_code_can GSKKCDDDSETSNWIAANTKECPKCHVTIEKDGGSNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 LYS n 1 5 CYS n 1 6 ASP n 1 7 ASP n 1 8 ASP n 1 9 SER n 1 10 GLU n 1 11 THR n 1 12 SER n 1 13 ASN n 1 14 TRP n 1 15 ILE n 1 16 ALA n 1 17 ALA n 1 18 ASN n 1 19 THR n 1 20 LYS n 1 21 GLU n 1 22 CYS n 1 23 PRO n 1 24 LYS n 1 25 CYS n 1 26 HIS n 1 27 VAL n 1 28 THR n 1 29 ILE n 1 30 GLU n 1 31 LYS n 1 32 ASP n 1 33 GLY n 1 34 GLY n 1 35 SER n 1 36 ASN n 1 37 HIS n 1 38 MET n 1 39 VAL n 1 40 CYS n 1 41 ARG n 1 42 ASN n 1 43 GLN n 1 44 ASN n 1 45 CYS n 1 46 LYS n 1 47 ALA n 1 48 GLU n 1 49 PHE n 1 50 CYS n 1 51 TRP n 1 52 VAL n 1 53 CYS n 1 54 LEU n 1 55 GLY n 1 56 PRO n 1 57 TRP n 1 58 GLU n 1 59 PRO n 1 60 HIS n 1 61 GLY n 1 62 SER n 1 63 ALA n 1 64 TRP n 1 65 TYR n 1 66 ASN n 1 67 CYS n 1 68 ASN n 1 69 ARG n 1 70 TYR n 1 71 ASN n 1 72 GLU n 1 73 ASP n 1 74 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ARIH1, ARI, MOP6, UBCH7BP, HUSSY-27' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6P-2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 323 323 GLY GLY A . n A 1 2 SER 2 324 324 SER SER A . n A 1 3 LYS 3 325 325 LYS LYS A . n A 1 4 LYS 4 326 326 LYS LYS A . n A 1 5 CYS 5 327 327 CYS CYS A . n A 1 6 ASP 6 328 328 ASP ASP A . n A 1 7 ASP 7 329 329 ASP ASP A . n A 1 8 ASP 8 330 330 ASP ASP A . n A 1 9 SER 9 331 331 SER SER A . n A 1 10 GLU 10 332 332 GLU GLU A . n A 1 11 THR 11 333 333 THR THR A . n A 1 12 SER 12 334 334 SER SER A . n A 1 13 ASN 13 335 335 ASN ASN A . n A 1 14 TRP 14 336 336 TRP TRP A . n A 1 15 ILE 15 337 337 ILE ILE A . n A 1 16 ALA 16 338 338 ALA ALA A . n A 1 17 ALA 17 339 339 ALA ALA A . n A 1 18 ASN 18 340 340 ASN ASN A . n A 1 19 THR 19 341 341 THR THR A . n A 1 20 LYS 20 342 342 LYS LYS A . n A 1 21 GLU 21 343 343 GLU GLU A . n A 1 22 CYS 22 344 344 CYS CYS A . n A 1 23 PRO 23 345 345 PRO PRO A . n A 1 24 LYS 24 346 346 LYS LYS A . n A 1 25 CYS 25 347 347 CYS CYS A . n A 1 26 HIS 26 348 348 HIS HIS A . n A 1 27 VAL 27 349 349 VAL VAL A . n A 1 28 THR 28 350 350 THR THR A . n A 1 29 ILE 29 351 351 ILE ILE A . n A 1 30 GLU 30 352 352 GLU GLU A . n A 1 31 LYS 31 353 353 LYS LYS A . n A 1 32 ASP 32 354 354 ASP ASP A . n A 1 33 GLY 33 355 355 GLY GLY A . n A 1 34 GLY 34 356 356 GLY GLY A . n A 1 35 SER 35 357 357 SER SER A . n A 1 36 ASN 36 358 358 ASN ASN A . n A 1 37 HIS 37 359 359 HIS HIS A . n A 1 38 MET 38 360 360 MET MET A . n A 1 39 VAL 39 361 361 VAL VAL A . n A 1 40 CYS 40 362 362 CYS CYS A . n A 1 41 ARG 41 363 363 ARG ARG A . n A 1 42 ASN 42 364 364 ASN ASN A . n A 1 43 GLN 43 365 365 GLN GLN A . n A 1 44 ASN 44 366 366 ASN ASN A . n A 1 45 CYS 45 367 367 CYS CYS A . n A 1 46 LYS 46 368 368 LYS LYS A . n A 1 47 ALA 47 369 369 ALA ALA A . n A 1 48 GLU 48 370 370 GLU GLU A . n A 1 49 PHE 49 371 371 PHE PHE A . n A 1 50 CYS 50 372 372 CYS CYS A . n A 1 51 TRP 51 373 373 TRP TRP A . n A 1 52 VAL 52 374 374 VAL VAL A . n A 1 53 CYS 53 375 375 CYS CYS A . n A 1 54 LEU 54 376 376 LEU LEU A . n A 1 55 GLY 55 377 377 GLY GLY A . n A 1 56 PRO 56 378 378 PRO PRO A . n A 1 57 TRP 57 379 379 TRP TRP A . n A 1 58 GLU 58 380 380 GLU GLU A . n A 1 59 PRO 59 381 381 PRO PRO A . n A 1 60 HIS 60 382 382 HIS HIS A . n A 1 61 GLY 61 383 383 GLY GLY A . n A 1 62 SER 62 384 384 SER SER A . n A 1 63 ALA 63 385 385 ALA ALA A . n A 1 64 TRP 64 386 386 TRP TRP A . n A 1 65 TYR 65 387 387 TYR TYR A . n A 1 66 ASN 66 388 388 ASN ASN A . n A 1 67 CYS 67 389 389 CYS CYS A . n A 1 68 ASN 68 390 390 ASN ASN A . n A 1 69 ARG 69 391 391 ARG ARG A . n A 1 70 TYR 70 392 392 TYR TYR A . n A 1 71 ASN 71 393 393 ASN ASN A . n A 1 72 GLU 72 394 394 GLU GLU A . n A 1 73 ASP 73 395 395 ASP ASP A . n A 1 74 ASP 74 396 396 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN A . C 2 ZN 1 402 2 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M9Y _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M9Y _struct.title 'Solution Structure of the Catalytic Domain of HHARI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M9Y _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'HHARI, RING2, E3 ligase, Zn-binding, LIGASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARI1_HUMAN _struct_ref.pdbx_db_accession Q9Y4X5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDD _struct_ref.pdbx_align_begin 325 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M9Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y4X5 _struct_ref_seq.db_align_beg 325 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 396 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 325 _struct_ref_seq.pdbx_auth_seq_align_end 396 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M9Y GLY A 1 ? UNP Q9Y4X5 ? ? 'expression tag' 323 1 1 2M9Y SER A 2 ? UNP Q9Y4X5 ? ? 'expression tag' 324 2 1 2M9Y SER A 35 ? UNP Q9Y4X5 CYS 357 'engineered mutation' 357 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TRP A 14 ? THR A 19 ? TRP A 336 THR A 341 1 ? 6 HELX_P HELX_P2 2 TRP A 57 ? GLY A 61 ? TRP A 379 GLY A 383 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 22 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 344 A ZN 401 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc2 metalc ? ? A CYS 25 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 347 A ZN 401 1_555 ? ? ? ? ? ? ? 2.239 ? ? metalc3 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 362 A ZN 401 1_555 ? ? ? ? ? ? ? 2.251 ? ? metalc4 metalc ? ? A CYS 45 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 367 A ZN 401 1_555 ? ? ? ? ? ? ? 2.291 ? ? metalc5 metalc ? ? A CYS 50 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 372 A ZN 402 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc6 metalc ? ? A CYS 53 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 375 A ZN 402 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc7 metalc ? ? A HIS 60 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 382 A ZN 402 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc8 metalc ? ? A CYS 67 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 389 A ZN 402 1_555 ? ? ? ? ? ? ? 2.215 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 22 ? A CYS 344 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 25 ? A CYS 347 ? 1_555 106.7 ? 2 SG ? A CYS 22 ? A CYS 344 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 40 ? A CYS 362 ? 1_555 114.6 ? 3 SG ? A CYS 25 ? A CYS 347 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 40 ? A CYS 362 ? 1_555 105.8 ? 4 SG ? A CYS 22 ? A CYS 344 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 45 ? A CYS 367 ? 1_555 115.1 ? 5 SG ? A CYS 25 ? A CYS 347 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 45 ? A CYS 367 ? 1_555 106.8 ? 6 SG ? A CYS 40 ? A CYS 362 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 45 ? A CYS 367 ? 1_555 107.2 ? 7 SG ? A CYS 50 ? A CYS 372 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SG ? A CYS 53 ? A CYS 375 ? 1_555 113.6 ? 8 SG ? A CYS 50 ? A CYS 372 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 60 ? A HIS 382 ? 1_555 99.5 ? 9 SG ? A CYS 53 ? A CYS 375 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 60 ? A HIS 382 ? 1_555 104.3 ? 10 SG ? A CYS 50 ? A CYS 372 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SG ? A CYS 67 ? A CYS 389 ? 1_555 118.9 ? 11 SG ? A CYS 53 ? A CYS 375 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SG ? A CYS 67 ? A CYS 389 ? 1_555 112.5 ? 12 NE2 ? A HIS 60 ? A HIS 382 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SG ? A CYS 67 ? A CYS 389 ? 1_555 105.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 37 ? VAL A 39 ? HIS A 359 VAL A 361 A 2 GLU A 48 ? CYS A 50 ? GLU A 370 CYS A 372 A 3 GLY A 55 ? PRO A 56 ? GLY A 377 PRO A 378 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 38 ? N MET A 360 O PHE A 49 ? O PHE A 371 A 2 3 N CYS A 50 ? N CYS A 372 O GLY A 55 ? O GLY A 377 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' AC2 Software A ZN 402 ? 4 'BINDING SITE FOR RESIDUE ZN A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 22 ? CYS A 344 . ? 1_555 ? 2 AC1 4 CYS A 25 ? CYS A 347 . ? 1_555 ? 3 AC1 4 CYS A 40 ? CYS A 362 . ? 1_555 ? 4 AC1 4 CYS A 45 ? CYS A 367 . ? 1_555 ? 5 AC2 4 CYS A 50 ? CYS A 372 . ? 1_555 ? 6 AC2 4 CYS A 53 ? CYS A 375 . ? 1_555 ? 7 AC2 4 HIS A 60 ? HIS A 382 . ? 1_555 ? 8 AC2 4 CYS A 67 ? CYS A 389 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 326 ? ? -108.13 -148.49 2 1 ALA A 339 ? ? -149.87 12.29 3 1 ILE A 351 ? ? -115.63 -168.50 4 1 CYS A 367 ? ? -142.62 -79.39 5 1 TRP A 386 ? ? 176.05 -24.47 6 2 CYS A 367 ? ? -135.87 -78.69 7 3 SER A 324 ? ? -170.77 143.11 8 3 ALA A 339 ? ? -149.58 12.28 9 3 ILE A 351 ? ? -105.33 -162.76 10 3 CYS A 367 ? ? -143.87 -79.51 11 3 ALA A 385 ? ? -146.40 -154.76 12 4 SER A 334 ? ? -76.87 26.70 13 4 ALA A 339 ? ? -145.25 16.04 14 4 HIS A 348 ? ? 60.59 67.12 15 4 ILE A 351 ? ? -109.16 -165.65 16 4 HIS A 359 ? ? -68.99 82.90 17 4 CYS A 367 ? ? -134.87 -75.93 18 4 ALA A 385 ? ? -160.32 -164.65 19 5 LYS A 325 ? ? -151.40 -17.11 20 5 GLU A 332 ? ? -92.29 51.38 21 5 ALA A 339 ? ? -141.77 14.54 22 5 ILE A 351 ? ? -106.44 -167.27 23 5 ASN A 358 ? ? 75.23 -38.97 24 5 CYS A 367 ? ? -142.63 -78.10 25 5 PRO A 381 ? ? -72.86 21.70 26 5 ASN A 390 ? ? -85.58 32.65 27 6 GLU A 332 ? ? 48.83 25.61 28 6 ALA A 339 ? ? -140.68 13.30 29 6 CYS A 367 ? ? -141.61 -77.26 30 6 ASN A 388 ? ? -105.31 -77.92 31 6 CYS A 389 ? ? 69.51 -2.63 32 7 ASP A 329 ? ? -122.64 -158.54 33 7 HIS A 348 ? ? 61.36 61.62 34 7 ILE A 351 ? ? -112.73 -164.15 35 7 ASN A 358 ? ? 78.65 -7.14 36 7 HIS A 359 ? ? -67.49 88.08 37 7 CYS A 367 ? ? -141.20 -73.15 38 7 PRO A 381 ? ? -70.84 -139.69 39 7 HIS A 382 ? ? 74.58 104.89 40 7 ASN A 390 ? ? -87.35 44.37 41 8 GLU A 332 ? ? 46.62 23.57 42 8 SER A 334 ? ? -75.72 30.58 43 8 ALA A 339 ? ? -148.89 15.73 44 8 ILE A 351 ? ? -108.30 -164.25 45 8 HIS A 359 ? ? -61.00 88.79 46 8 CYS A 367 ? ? -140.69 -78.31 47 8 ASN A 390 ? ? -91.78 45.18 48 9 SER A 331 ? ? -94.37 48.73 49 9 HIS A 348 ? ? 62.85 68.14 50 9 ILE A 351 ? ? -104.55 -160.84 51 9 CYS A 367 ? ? -140.77 -76.36 52 9 CYS A 389 ? ? 56.84 17.10 53 10 ASP A 328 ? ? -143.30 40.97 54 10 ALA A 339 ? ? -149.14 11.14 55 10 ILE A 351 ? ? -105.77 -163.88 56 10 CYS A 367 ? ? -139.74 -77.19 57 10 ASN A 390 ? ? -69.15 1.03 58 10 TYR A 392 ? ? -138.22 -37.51 59 11 ASP A 329 ? ? 67.07 -12.95 60 11 ILE A 351 ? ? -101.14 -161.79 61 11 CYS A 367 ? ? -141.96 -77.89 62 11 SER A 384 ? ? 52.53 84.13 63 12 ASP A 329 ? ? -109.83 -82.08 64 12 HIS A 348 ? ? 60.74 68.41 65 12 ILE A 351 ? ? -102.16 -162.58 66 12 CYS A 367 ? ? -144.28 -76.22 67 12 ASN A 390 ? ? -92.94 32.24 68 13 ILE A 351 ? ? -101.01 -166.14 69 13 HIS A 359 ? ? -65.49 95.35 70 13 CYS A 367 ? ? -140.23 -78.89 71 14 SER A 334 ? ? -82.58 32.41 72 14 ILE A 351 ? ? -94.91 -159.33 73 14 CYS A 367 ? ? -146.16 -77.33 74 14 PRO A 381 ? ? -65.05 2.21 75 14 ARG A 391 ? ? -128.25 -59.81 76 15 SER A 334 ? ? -76.75 36.12 77 15 ALA A 339 ? ? -141.96 13.33 78 15 HIS A 348 ? ? 66.72 72.40 79 15 ILE A 351 ? ? -104.70 -164.38 80 15 HIS A 359 ? ? -62.67 86.46 81 15 CYS A 367 ? ? -139.20 -75.90 82 15 PRO A 381 ? ? -69.74 0.14 83 16 ALA A 339 ? ? -143.21 20.03 84 16 HIS A 348 ? ? 61.47 67.10 85 16 ILE A 351 ? ? -110.54 -163.81 86 16 ASN A 358 ? ? 75.37 -20.68 87 16 HIS A 359 ? ? -65.59 87.80 88 16 CYS A 367 ? ? -142.12 -76.09 89 16 HIS A 382 ? ? -75.39 -91.07 90 16 ALA A 385 ? ? -88.92 -71.20 91 16 TRP A 386 ? ? -156.32 -152.55 92 16 TYR A 387 ? ? 70.72 88.80 93 17 SER A 331 ? ? -91.58 32.84 94 17 ILE A 351 ? ? -107.26 -165.49 95 17 CYS A 367 ? ? -136.82 -77.02 96 17 SER A 384 ? ? 63.19 80.76 97 18 ASP A 329 ? ? -73.19 -166.89 98 18 ILE A 351 ? ? -104.46 -163.17 99 18 CYS A 367 ? ? -137.94 -77.68 100 18 ALA A 385 ? ? -163.01 -169.06 101 18 TRP A 386 ? ? -79.51 -157.58 102 18 TYR A 387 ? ? 74.04 106.01 103 18 ASN A 390 ? ? -81.46 44.69 104 18 TYR A 392 ? ? -137.92 -41.94 105 19 LYS A 325 ? ? -112.38 68.75 106 19 ASP A 329 ? ? -73.80 -164.95 107 19 SER A 334 ? ? -77.74 40.76 108 19 HIS A 348 ? ? 61.13 68.40 109 19 ILE A 351 ? ? -101.82 -164.52 110 19 CYS A 367 ? ? -129.58 -79.68 111 19 SER A 384 ? ? 55.49 83.23 112 19 ALA A 385 ? ? -144.35 -65.70 113 19 TRP A 386 ? ? -175.96 -26.26 114 20 GLU A 332 ? ? 59.97 3.27 115 20 ILE A 351 ? ? -103.48 -165.86 116 20 CYS A 367 ? ? -144.59 -76.64 117 20 PRO A 381 ? ? -65.15 3.20 118 20 SER A 384 ? ? 57.68 82.09 119 20 TYR A 392 ? ? -128.66 -59.38 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M9Y _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0 _pdbx_nmr_ensemble_rms.entry_id 2M9Y _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M9Y _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM MES, 120 mM sodium chloride, 5 mM DTT, 2.3 mM [U-98% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '20 mM MES, 120 mM sodium chloride, 5 mM DTT, 2.3 mM [U-98% 13C; U-98% 15N] protein, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MES-1 20 ? mM ? 1 'sodium chloride-2' 120 ? mM ? 1 DTT-3 5 ? mM ? 1 entity_1-4 2.3 ? mM '[U-98% 15N]' 1 MES-5 20 ? mM ? 2 'sodium chloride-6' 120 ? mM ? 2 DTT-7 5 ? mM ? 2 entity_1-8 2.3 ? mM '[U-98% 13C; U-98% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC aliphatic' 1 3 2 '2D 1H-13C HSQC aromatic' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 2 '3D 1H-13C NOESY aromatic' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 2 '3D 1H-13C NOESY aliphatic' 1 10 2 '2D (HB)CB(CGCD)HD' 1 11 2 '2D (HB)CB(CGCDCE)HE' 1 12 2 '2D HCN' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M9Y _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1321 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 349 _pdbx_nmr_constraints.NOE_long_range_total_count 380 _pdbx_nmr_constraints.NOE_medium_range_total_count 179 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 413 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2M9Y _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details 'WITH EXPLICIT SOLVENT AND FULL ELECTROSTATICS, WITH EXPLICIT SOLVENT AND FULL ELECTROSTATICS' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ 'Varian VnmrJ 2.2D' 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2013.021.23.09 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw 'Ver 7.9 Rev 2013.021.23.09' 3 'Johnson, One Moon Scientific' 'data analysis' NMRView 9.0.0beta76 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 9.0.0beta76 5 'Johnson, One Moon Scientific' 'peak picking' NMRView 9.0.0beta76 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.33 8 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Tho' 'data analysis' Procheck 3.5.4 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2M9Y _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #