data_2MA6 # _entry.id 2MA6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MA6 pdb_00002ma6 10.2210/pdb2ma6/pdb RCSB RCSB103402 ? ? BMRB 19329 ? 10.13018/BMR19329 WWPDB D_1000103402 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-31 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_ref_seq_dif 9 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 2 'Structure model' '_struct_ref_seq_dif.details' 27 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MA6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19329 BMRB unspecified . NESG-HR8700A TargetTrack unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Yang, Y.' 2 'Janjua, H.' 3 'Kohan, E.' 4 'Wang, H.' 5 'Xiao, R.' 6 'Acton, T.B.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Kennedy, M.A.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title ;Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramelot, T.A.' 1 ? primary 'Yang, Y.' 2 ? primary 'Janjua, H.' 3 ? primary 'Kohan, E.' 4 ? primary 'Wang, H.' 5 ? primary 'Xiao, R.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Montelione, G.T.' 9 ? primary 'Kennedy, M.A.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase RNF123' 6882.918 1 6.3.2.- ? 'UNP residues 1247-1304' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kip1 ubiquitination-promoting complex protein 1, RING finger protein 123' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG _entity_poly.pdbx_seq_one_letter_code_can SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR8700A # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 HIS n 1 3 MET n 1 4 PRO n 1 5 THR n 1 6 SER n 1 7 GLU n 1 8 GLU n 1 9 ASP n 1 10 LEU n 1 11 CYS n 1 12 PRO n 1 13 ILE n 1 14 CYS n 1 15 TYR n 1 16 ALA n 1 17 HIS n 1 18 PRO n 1 19 ILE n 1 20 SER n 1 21 ALA n 1 22 VAL n 1 23 PHE n 1 24 GLN n 1 25 PRO n 1 26 CYS n 1 27 GLY n 1 28 HIS n 1 29 LYS n 1 30 SER n 1 31 CYS n 1 32 LYS n 1 33 ALA n 1 34 CYS n 1 35 ILE n 1 36 ASN n 1 37 GLN n 1 38 HIS n 1 39 LEU n 1 40 MET n 1 41 ASN n 1 42 ASN n 1 43 LYS n 1 44 ASP n 1 45 CYS n 1 46 PHE n 1 47 PHE n 1 48 CYS n 1 49 LYS n 1 50 THR n 1 51 THR n 1 52 ILE n 1 53 VAL n 1 54 SER n 1 55 VAL n 1 56 GLU n 1 57 ASP n 1 58 TRP n 1 59 GLU n 1 60 LYS n 1 61 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FP1477, KPC1, RNF123' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details pET15Avi6HT_NESG _entity_src_gen.pdbx_description plasmid # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 62 ZN ZN A . C 2 ZN 1 102 63 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MA6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MA6 _struct.title ;Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A ; _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MA6 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, Ring fing domain, Zinc binding protein, LIGASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RN123_HUMAN _struct_ref.pdbx_db_accession Q5XPI4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG _struct_ref.pdbx_align_begin 1247 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MA6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5XPI4 _struct_ref_seq.db_align_beg 1247 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1304 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MA6 SER A 1 ? UNP Q5XPI4 ? ? 'expression tag' 1 1 1 2MA6 HIS A 2 ? UNP Q5XPI4 ? ? 'expression tag' 2 2 1 2MA6 MET A 3 ? UNP Q5XPI4 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 39 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 101 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc2 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 101 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc3 metalc ? ? A CYS 26 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 26 A ZN 102 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc4 metalc ? ? A HIS 28 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 28 A ZN 102 1_555 ? ? ? ? ? ? ? 2.066 ? ? metalc5 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 101 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc6 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 101 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc7 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 45 A ZN 102 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc8 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 102 1_555 ? ? ? ? ? ? ? 2.345 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 1_555 110.9 ? 2 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 110.7 ? 3 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 110.3 ? 4 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 108.3 ? 5 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 108.2 ? 6 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 108.3 ? 7 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 107.3 ? 8 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 109.6 ? 9 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 108.6 ? 10 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 111.7 ? 11 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 110.3 ? 12 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 109.3 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 1 -2.89 2 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 2 -1.76 3 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 3 4.47 4 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 4 4.24 5 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 5 -1.30 6 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 6 -3.09 7 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 7 -2.38 8 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 8 3.15 9 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 9 -1.94 10 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 10 1.85 11 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 11 -3.30 12 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 12 -3.62 13 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 13 7.61 14 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 14 1.74 15 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 15 0.41 16 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 16 -0.27 17 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 17 3.34 18 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 18 2.21 19 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 19 3.44 20 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 20 -9.43 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 28 ? SER A 30 ? HIS A 28 SER A 30 A 2 ALA A 21 ? GLN A 24 ? ALA A 21 GLN A 24 A 3 SER A 54 ? ASP A 57 ? SER A 54 ASP A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 28 ? O HIS A 28 N PHE A 23 ? N PHE A 23 A 2 3 N VAL A 22 ? N VAL A 22 O GLU A 56 ? O GLU A 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software A ZN 102 ? 4 'BINDING SITE FOR RESIDUE ZN A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 2 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 4 AC1 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 5 AC2 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 6 AC2 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 7 AC2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 8 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 8 ? ? -137.60 -156.58 2 1 ASP A 9 ? ? -81.50 43.34 3 1 TYR A 15 ? ? 68.03 -47.02 4 1 SER A 20 ? ? -150.17 -4.01 5 1 SER A 30 ? ? -161.19 -169.70 6 1 ASN A 41 ? ? -116.09 -74.19 7 1 ASN A 42 ? ? -125.28 -168.09 8 1 CYS A 45 ? ? -94.19 36.15 9 1 PHE A 46 ? ? 54.16 -82.39 10 1 CYS A 48 ? ? -143.14 -7.13 11 2 SER A 6 ? ? -91.97 53.42 12 2 GLU A 8 ? ? 61.33 -178.08 13 2 CYS A 14 ? ? -124.75 -51.38 14 2 TYR A 15 ? ? 71.69 -8.83 15 2 SER A 20 ? ? -142.65 15.27 16 2 CYS A 26 ? ? -142.95 -39.84 17 2 SER A 30 ? ? -174.40 -176.19 18 2 ASN A 41 ? ? -116.90 -73.58 19 2 ASN A 42 ? ? -125.39 -167.26 20 2 PHE A 46 ? ? 63.40 -85.69 21 3 GLU A 7 ? ? 69.46 177.86 22 3 TYR A 15 ? ? 74.66 -37.96 23 3 PRO A 18 ? ? -77.49 -169.80 24 3 SER A 20 ? ? -141.56 -10.96 25 3 CYS A 26 ? ? -67.08 -70.41 26 3 ASN A 41 ? ? -115.98 -75.84 27 3 PHE A 46 ? ? 47.71 -90.84 28 4 MET A 3 ? ? -161.37 81.57 29 4 PRO A 4 ? ? -64.85 85.18 30 4 ASP A 9 ? ? -66.42 75.39 31 4 TYR A 15 ? ? 75.30 -36.23 32 4 PRO A 18 ? ? -73.98 -165.08 33 4 ASN A 41 ? ? -133.92 -68.25 34 4 CYS A 45 ? ? -93.19 50.23 35 4 PHE A 46 ? ? 52.44 -84.03 36 5 TYR A 15 ? ? 81.90 -35.87 37 5 PRO A 18 ? ? -79.26 -165.02 38 5 ASN A 41 ? ? -106.28 -73.50 39 5 ASN A 42 ? ? -103.06 -168.60 40 5 LYS A 43 ? ? -150.55 22.33 41 5 CYS A 45 ? ? -91.73 39.24 42 5 PHE A 46 ? ? 57.05 -84.98 43 6 PRO A 4 ? ? -53.87 92.83 44 6 THR A 5 ? ? -138.29 -42.31 45 6 GLU A 8 ? ? -72.99 22.03 46 6 CYS A 11 ? ? -58.66 108.08 47 6 CYS A 14 ? ? -131.03 -55.09 48 6 PRO A 18 ? ? -84.15 47.26 49 6 ILE A 19 ? ? 68.21 143.63 50 6 SER A 20 ? ? -155.11 19.90 51 6 ASN A 41 ? ? -100.73 -67.90 52 6 PHE A 46 ? ? 42.97 -85.93 53 6 LYS A 49 ? ? 54.26 17.74 54 7 THR A 5 ? ? -68.15 98.51 55 7 TYR A 15 ? ? 77.78 -51.89 56 7 ILE A 19 ? ? 61.88 170.42 57 7 SER A 20 ? ? -156.31 -37.91 58 7 PRO A 25 ? ? -93.59 37.53 59 7 CYS A 26 ? ? -75.66 -78.64 60 7 SER A 30 ? ? -164.28 -168.91 61 7 ASN A 41 ? ? -104.38 -68.58 62 7 PHE A 46 ? ? 47.37 -81.48 63 8 THR A 5 ? ? -147.84 -44.08 64 8 GLU A 8 ? ? -118.43 70.98 65 8 CYS A 11 ? ? -53.07 109.29 66 8 TYR A 15 ? ? 67.27 -60.44 67 8 PRO A 18 ? ? -75.39 -164.42 68 8 SER A 30 ? ? -166.37 -164.57 69 8 ASN A 41 ? ? -149.41 -57.58 70 8 LYS A 43 ? ? -159.69 54.18 71 8 PHE A 47 ? ? -76.91 -75.23 72 9 THR A 5 ? ? -163.83 -30.74 73 9 SER A 6 ? ? 66.62 93.20 74 9 GLU A 8 ? ? -99.65 56.20 75 9 TYR A 15 ? ? 75.19 -39.37 76 9 PRO A 18 ? ? -79.09 -159.63 77 9 SER A 30 ? ? -172.18 -179.87 78 9 ASN A 41 ? ? -76.09 -70.41 79 9 CYS A 45 ? ? -96.02 54.35 80 9 PHE A 46 ? ? 49.68 -84.61 81 9 ASP A 57 ? ? -67.63 96.60 82 10 HIS A 2 ? ? -167.40 93.87 83 10 MET A 3 ? ? 59.33 92.60 84 10 THR A 5 ? ? 47.12 25.58 85 10 TYR A 15 ? ? 80.39 -42.42 86 10 PRO A 18 ? ? -75.64 -163.51 87 10 SER A 30 ? ? -170.20 -176.07 88 10 ASN A 41 ? ? -134.83 -70.42 89 10 CYS A 45 ? ? -94.51 37.00 90 10 PHE A 46 ? ? 58.65 -86.32 91 10 PHE A 47 ? ? -87.66 44.71 92 10 CYS A 48 ? ? 175.80 -31.96 93 11 THR A 5 ? ? 70.25 159.95 94 11 GLU A 8 ? ? 53.39 -152.10 95 11 CYS A 14 ? ? -134.39 -51.62 96 11 TYR A 15 ? ? 78.95 -40.08 97 11 PRO A 18 ? ? -76.02 -165.70 98 11 SER A 20 ? ? -136.13 -32.65 99 11 CYS A 26 ? ? -143.11 -64.52 100 11 ASN A 41 ? ? -105.87 -67.22 101 11 CYS A 45 ? ? -90.24 52.75 102 11 PHE A 46 ? ? 54.97 -80.25 103 12 HIS A 2 ? ? 60.31 91.38 104 12 GLU A 7 ? ? 56.92 -164.43 105 12 GLU A 8 ? ? 66.81 176.32 106 12 ASP A 9 ? ? -83.28 39.20 107 12 TYR A 15 ? ? 75.48 -46.45 108 12 CYS A 26 ? ? -81.36 -74.81 109 12 ASN A 41 ? ? -112.28 -75.12 110 12 CYS A 45 ? ? -94.62 46.05 111 12 PHE A 46 ? ? 54.19 -82.90 112 13 PRO A 4 ? ? -56.21 103.30 113 13 GLU A 7 ? ? -95.94 33.55 114 13 TYR A 15 ? ? 78.39 -40.32 115 13 SER A 20 ? ? -150.13 19.73 116 13 ASN A 41 ? ? -111.34 -73.13 117 13 CYS A 45 ? ? -91.39 38.65 118 13 PHE A 46 ? ? 57.43 -84.66 119 13 LYS A 49 ? ? 59.94 13.19 120 14 GLU A 7 ? ? -116.26 -77.63 121 14 TYR A 15 ? ? 80.02 -41.57 122 14 PRO A 18 ? ? -78.82 -166.23 123 14 SER A 20 ? ? -141.96 -14.70 124 14 PRO A 25 ? ? -97.95 31.15 125 14 SER A 30 ? ? -169.19 -166.43 126 14 ASN A 41 ? ? -121.09 -64.91 127 14 PHE A 46 ? ? 58.93 -86.00 128 14 LYS A 49 ? ? 66.97 -2.27 129 15 HIS A 2 ? ? 66.67 117.45 130 15 TYR A 15 ? ? 79.98 -54.77 131 15 PRO A 18 ? ? -75.27 -167.83 132 15 SER A 20 ? ? -154.87 25.12 133 15 CYS A 45 ? ? -87.70 37.37 134 15 PHE A 46 ? ? 57.60 -85.30 135 15 LYS A 49 ? ? 66.39 -4.18 136 15 TRP A 58 ? ? -69.46 95.55 137 16 MET A 3 ? ? -164.43 81.94 138 16 THR A 5 ? ? 70.99 -5.88 139 16 GLU A 8 ? ? -163.31 -169.03 140 16 TYR A 15 ? ? 76.81 -39.17 141 16 PRO A 18 ? ? -72.66 -166.07 142 16 ASN A 41 ? ? -84.18 -76.33 143 16 PHE A 47 ? ? -139.38 -77.20 144 17 THR A 5 ? ? -145.67 -82.53 145 17 GLU A 7 ? ? 64.45 -178.08 146 17 GLU A 8 ? ? -116.59 -163.31 147 17 TYR A 15 ? ? 77.09 -32.29 148 17 PRO A 18 ? ? -76.91 -159.60 149 17 ASN A 41 ? ? -106.02 -73.86 150 17 CYS A 45 ? ? -91.66 32.87 151 17 PHE A 46 ? ? 57.70 -83.46 152 18 ASP A 9 ? ? 75.17 77.37 153 18 TYR A 15 ? ? 74.84 -43.32 154 18 PRO A 18 ? ? -71.36 -164.55 155 18 SER A 30 ? ? -168.72 -157.34 156 18 ASN A 41 ? ? -105.15 -72.89 157 18 CYS A 45 ? ? -93.61 32.50 158 18 PHE A 46 ? ? 59.40 -84.35 159 19 MET A 3 ? ? 61.96 90.48 160 19 ASP A 9 ? ? -77.83 40.53 161 19 CYS A 14 ? ? -133.33 -42.06 162 19 TYR A 15 ? ? 77.94 -37.64 163 19 ILE A 19 ? ? 63.07 155.50 164 19 SER A 20 ? ? -159.81 -7.60 165 19 PRO A 25 ? ? -92.44 32.21 166 19 CYS A 26 ? ? -83.49 -72.83 167 19 SER A 30 ? ? -142.13 -155.94 168 19 ASN A 41 ? ? -131.37 -73.17 169 19 LYS A 43 ? ? -145.34 35.36 170 19 CYS A 48 ? ? -149.61 22.72 171 19 LYS A 49 ? ? 71.24 -28.22 172 20 TYR A 15 ? ? 74.69 -44.64 173 20 SER A 20 ? ? -142.29 13.42 174 20 ASN A 41 ? ? -88.30 -75.81 175 20 CYS A 45 ? ? -98.49 45.87 176 20 PHE A 46 ? ? 57.39 -87.31 177 20 ILE A 52 ? ? -59.51 105.70 178 20 ASP A 57 ? ? -69.46 96.80 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MA6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MA6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.0 mM [U-15N] 5% 13C-fractional labeling HR8700A.005, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1.0 mM [U-100% 13C; U-100% 15N] HR8700A.005, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 100 % D2O, 50 uM DSS, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.9 mM [U-100% 15N] 5% 13C-fractional labeling HR8700A.007, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR8700A.005-1 1.0 ? mM '[U-15N] 5% 13C-fractional labeling' 1 NaN3-2 0.02 ? % ? 1 DTT-3 10 ? mM ? 1 CaCL2-4 5 ? mM ? 1 NaCL-5 100 ? mM ? 1 'Proteinase Inhibitors-6' 1 ? % ? 1 'MES pH 6.5-7' 20 ? mM ? 1 D2O-8 10 ? % ? 1 DSS-9 50 ? uM ? 1 HR8700A.005-10 1.0 ? mM '[U-100% 13C; U-100% 15N]' 2 NaN3-11 0.02 ? % ? 2 DTT-12 10 ? mM ? 2 CaCL2-13 5 ? mM ? 2 NaCL-14 100 ? mM ? 2 'Proteinase Inhibitors-15' 1 ? % ? 2 'MES pH 6.5-16' 20 ? mM ? 2 D2O-17 100 ? % ? 2 DSS-18 50 ? uM ? 2 HR8700A.007-19 0.9 ? mM '[U-100% 15N] 5% 13C-fractional labeling' 3 NaN3-20 0.02 ? % ? 3 DTT-21 10 ? mM ? 3 CaCL2-22 5 ? mM ? 3 NaCL-23 100 ? mM ? 3 'Proteinase Inhibitors-24' 1 ? % ? 3 'MES pH 6.5-25' 20 ? mM ? 3 D2O-26 10 ? % ? 3 DSS-27 50 ? uM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic CT' 1 4 1 '2D 1H-13C HSQC aromatic noCT' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-15N NOESY NUS' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aliphatic NUS' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 2 '2D 1H-13C HSQC aliphatic' 1 11 1 '3D C(CO)NH' 1 12 1 '3D H(CCO)NH' 1 13 1 '3D HCCH-COSY' 1 14 3 '2D 1H-15N HSQC' 1 15 3 '2D 1H-13C HSQC aliphatic' 1 16 3 '2D 1H-15N HSQC HIS' 1 17 1 '1D T1 NSQC array' 1 18 1 '1D T2 NHSQC array' 1 19 1 '3D CBCA(CO)NH' 1 20 1 '3D HNCACB' 1 21 1 '3D HBHA(CO)NH' 1 22 1 '3D HNCO' 1 23 1 '2D 1H-15N HSQC NH2 only' 1 24 2 '4D HCCH NOESY' 1 25 2 '3D CCH-TOCSY' 1 26 2 '2D 1H-15N HSQC' 1 27 1 '2D 1H-15N HSQC' 1 28 1 '3D HCCH-TOCSY' # _pdbx_nmr_refine.entry_id 2MA6 _pdbx_nmr_refine.method 'simulated annealing, null' _pdbx_nmr_refine.details 'CNS water refinement of Cyana structures via fmcGui, null' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS 1.3 1 'Guntert, Mumenthaler and Wuthrich' 'refinement,geometry optimization,structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe NMRPipe-2008 4 'Bruker Biospin' collection TopSpin 2.4 5 Varian collection VnmrJ vnmrj_1.1_D 6 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 7 Goddard 'data analysis' Sparky 3.113 8 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ 'Version 1.2009.0721.18' 9 'Bhattacharya, Montelione' 'structure validation' PSVS 1.4 10 'Alex Lemak, Cheryl Arrowmith' refinement FMCGUI fmcgui2.5_linux 11 ? refinement CNS ? 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TRP N N N N 291 TRP CA C N S 292 TRP C C N N 293 TRP O O N N 294 TRP CB C N N 295 TRP CG C Y N 296 TRP CD1 C Y N 297 TRP CD2 C Y N 298 TRP NE1 N Y N 299 TRP CE2 C Y N 300 TRP CE3 C Y N 301 TRP CZ2 C Y N 302 TRP CZ3 C Y N 303 TRP CH2 C Y N 304 TRP OXT O N N 305 TRP H H N N 306 TRP H2 H N N 307 TRP HA H N N 308 TRP HB2 H N N 309 TRP HB3 H N N 310 TRP HD1 H N N 311 TRP HE1 H N N 312 TRP HE3 H N N 313 TRP HZ2 H N N 314 TRP HZ3 H N N 315 TRP HH2 H N N 316 TRP HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TRP N CA sing N N 278 TRP N H sing N N 279 TRP N H2 sing N N 280 TRP CA C sing N N 281 TRP CA CB sing N N 282 TRP CA HA sing N N 283 TRP C O doub N N 284 TRP C OXT sing N N 285 TRP CB CG sing N N 286 TRP CB HB2 sing N N 287 TRP CB HB3 sing N N 288 TRP CG CD1 doub Y N 289 TRP CG CD2 sing Y N 290 TRP CD1 NE1 sing Y N 291 TRP CD1 HD1 sing N N 292 TRP CD2 CE2 doub Y N 293 TRP CD2 CE3 sing Y N 294 TRP NE1 CE2 sing Y N 295 TRP NE1 HE1 sing N N 296 TRP CE2 CZ2 sing Y N 297 TRP CE3 CZ3 doub Y N 298 TRP CE3 HE3 sing N N 299 TRP CZ2 CH2 doub Y N 300 TRP CZ2 HZ2 sing N N 301 TRP CZ3 CH2 sing Y N 302 TRP CZ3 HZ3 sing N N 303 TRP CH2 HH2 sing N N 304 TRP OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 850 Bruker 'AVANCE II' 1 'Bruker Avance II' 600 Varian INOVA 2 'Varian INOVA' 600 Bruker 'AVANCE III' 3 'Bruker Avance III' # _atom_sites.entry_id 2MA6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_