data_2MAL # _entry.id 2MAL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MAL RCSB RCSB103415 BMRB 19365 WWPDB D_1000103415 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2013-10-02 _pdbx_database_PDB_obs_spr.pdb_id 2MAL _pdbx_database_PDB_obs_spr.replace_pdb_id 2LJO _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1LIP PDB . unspecified 1AFH PDB . unspecified 1SIY PDB . unspecified 1RZL PDB . unspecified 1BV2 PDB . unspecified 1UVA PDB . unspecified 1UVB PDB . unspecified 1UVC PDB . unspecified 1T12 PDB . unspecified 1GH1 PDB . unspecified 1CZ2 PDB . unspecified 1BWO PDB . unspecified 19365 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MAL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-07-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gizatullina, A.K.' 1 'Mineev, K.S.' 2 'Shenkarev, Z.O.' 3 # _citation.id primary _citation.title 'Recombinant production and solution structure of lipid transfer protein from lentil Lens culinaris.' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 439 _citation.page_first 427 _citation.page_last 432 _citation.year 2013 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23998937 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2013.08.078 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gizatullina, A.K.' 1 primary 'Finkina, E.I.' 2 primary 'Mineev, K.S.' 3 primary 'Melnikova, D.N.' 4 primary 'Bogdanov, I.V.' 5 primary 'Telezhinskaya, I.N.' 6 primary 'Balandin, S.V.' 7 primary 'Shenkarev, Z.O.' 8 primary 'Arseniev, A.S.' 9 primary 'Ovchinnikova, T.V.' 10 # _cell.entry_id 2MAL _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MAL _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Non-specific lipid-transfer protein 2' _entity.formula_weight 9299.694 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LTP2, Non-specific lipid-transfer protein 7, LTP7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPY KISTTTNCNTVKF ; _entity_poly.pdbx_seq_one_letter_code_can ;AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPY KISTTTNCNTVKF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ILE n 1 3 SER n 1 4 CYS n 1 5 GLY n 1 6 ALA n 1 7 VAL n 1 8 THR n 1 9 SER n 1 10 ASP n 1 11 LEU n 1 12 SER n 1 13 PRO n 1 14 CYS n 1 15 LEU n 1 16 THR n 1 17 TYR n 1 18 LEU n 1 19 THR n 1 20 GLY n 1 21 GLY n 1 22 PRO n 1 23 GLY n 1 24 PRO n 1 25 SER n 1 26 PRO n 1 27 GLN n 1 28 CYS n 1 29 CYS n 1 30 GLY n 1 31 GLY n 1 32 VAL n 1 33 LYS n 1 34 LYS n 1 35 LEU n 1 36 LEU n 1 37 ALA n 1 38 ALA n 1 39 ALA n 1 40 ASN n 1 41 THR n 1 42 THR n 1 43 PRO n 1 44 ASP n 1 45 ARG n 1 46 GLN n 1 47 ALA n 1 48 ALA n 1 49 CYS n 1 50 ASN n 1 51 CYS n 1 52 LEU n 1 53 LYS n 1 54 SER n 1 55 ALA n 1 56 ALA n 1 57 GLY n 1 58 SER n 1 59 ILE n 1 60 THR n 1 61 LYS n 1 62 LEU n 1 63 ASN n 1 64 THR n 1 65 ASN n 1 66 ASN n 1 67 ALA n 1 68 ALA n 1 69 ALA n 1 70 LEU n 1 71 PRO n 1 72 GLY n 1 73 LYS n 1 74 CYS n 1 75 GLY n 1 76 VAL n 1 77 ASN n 1 78 ILE n 1 79 PRO n 1 80 TYR n 1 81 LYS n 1 82 ILE n 1 83 SER n 1 84 THR n 1 85 THR n 1 86 THR n 1 87 ASN n 1 88 CYS n 1 89 ASN n 1 90 THR n 1 91 VAL n 1 92 LYS n 1 93 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Lentil _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lens culinaris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3864 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-His8-TrxL-Lc-LTP2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NLTP2_LENCU _struct_ref.pdbx_db_accession A0AT29 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPY KISTTTNCNTVKF ; _struct_ref.pdbx_align_begin 26 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MAL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0AT29 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 118 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-15N HSQC' 1 5 2 '3D 1H-15N NOESY' 1 6 2 '3D 1H-15N TOCSY' 1 7 2 '3D HNHA' 1 8 2 '3D HNHB' 1 9 3 '3D 1H-13C NOESY' 1 10 3 '3D HCCH-TOCSY' 1 11 3 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.4 mM [U-100% 15N] Lc-LTP2, 100% D2O' 1 '100% D2O' '1.4 mM [U-100% 15N] Lc-LTP2, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '1.0-1.5 mM [U-100% 13C; U-100% 15N] Lc-LTP2, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MAL _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MAL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MAL _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'peak picking' XEASY ? 1 'Keller and Wuthrich' 'chemical shift assignment' XEASY ? 2 'Guntert, Mumenthaler and Wuthrich' 'data analysis' CYANA ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Cornilescu, Delaglio and Bax' refinement TALOS ? 5 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Tho' refinement Procheck ? 6 ? refinement CYANA ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MAL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MAL _struct.title 'Solution structure of Lipid Transfer Protein from Lentil Lens Culinaris' _struct.pdbx_descriptor 'Non-specific lipid-transfer protein 2' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MAL _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'plant lipid transfer protein, Lens Culinaris, LIPID TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 8 ? LEU A 18 ? THR A 8 LEU A 18 1 ? 11 HELX_P HELX_P2 2 PRO A 26 ? ALA A 37 ? PRO A 26 ALA A 37 1 ? 12 HELX_P HELX_P3 3 THR A 42 ? ALA A 55 ? THR A 42 ALA A 55 1 ? 14 HELX_P HELX_P4 4 ALA A 56 ? SER A 58 ? ALA A 56 SER A 58 5 ? 3 HELX_P HELX_P5 5 THR A 64 ? LYS A 73 ? THR A 64 LYS A 73 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 4 A CYS 51 1_555 ? ? ? ? ? ? ? 2.007 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 14 A CYS 28 1_555 ? ? ? ? ? ? ? 1.947 ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 29 A CYS 74 1_555 ? ? ? ? ? ? ? 1.964 ? disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 49 A CYS 88 1_555 ? ? ? ? ? ? ? 2.095 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 1 0.12 2 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 2 0.15 3 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 3 0.03 4 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 4 0.05 5 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 5 0.07 6 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 6 0.06 7 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 7 0.10 8 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 8 0.07 9 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 9 0.01 10 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 10 0.05 11 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 11 0.08 12 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 12 0.03 13 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 13 0.07 14 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 14 0.11 15 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 15 -0.02 16 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 16 0.05 17 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 17 0.06 18 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 18 0.04 19 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 19 0.17 20 GLY 23 A . ? GLY 23 A PRO 24 A ? PRO 24 A 20 0.07 # _atom_sites.entry_id 2MAL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 PHE 93 93 93 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-02 2 'Structure model' 1 1 2013-10-16 3 'Structure model' 1 2 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' struct_conf 2 3 'Structure model' struct_conf_type # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Lc-LTP2-1 1.4 ? mM '[U-100% 15N]' 1 Lc-LTP2-2 1.4 ? mM '[U-100% 15N]' 2 Lc-LTP2-3 ? 1.0-1.5 mM '[U-100% 13C; U-100% 15N]' 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MAL _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 817 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 290 _pdbx_nmr_constraints.NOE_long_range_total_count 79 _pdbx_nmr_constraints.NOE_medium_range_total_count 240 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 208 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -95.41 -75.18 2 1 CYS A 4 ? ? -175.86 -41.00 3 2 SER A 3 ? ? -95.18 -74.81 4 2 CYS A 4 ? ? -175.69 -37.94 5 2 THR A 90 ? ? -94.90 44.03 6 3 SER A 3 ? ? -95.51 -74.66 7 3 CYS A 4 ? ? -175.47 -37.18 8 3 SER A 83 ? ? -175.12 -171.28 9 4 SER A 3 ? ? -143.08 -71.46 10 4 CYS A 4 ? ? -175.62 -39.27 11 4 SER A 83 ? ? -171.51 -172.94 12 5 SER A 3 ? ? -95.16 -75.26 13 5 CYS A 4 ? ? -175.86 -44.43 14 6 SER A 3 ? ? -95.18 -75.47 15 6 CYS A 4 ? ? -176.14 -41.27 16 6 TYR A 80 ? ? -124.65 -169.85 17 6 THR A 90 ? ? -113.80 54.81 18 7 SER A 3 ? ? -95.16 -75.09 19 7 CYS A 4 ? ? -175.72 -40.74 20 8 SER A 3 ? ? -95.17 -74.95 21 8 CYS A 4 ? ? -175.62 -40.03 22 9 SER A 3 ? ? -143.20 -70.36 23 9 CYS A 4 ? ? -175.61 -37.78 24 9 SER A 83 ? ? -174.75 -178.12 25 10 SER A 3 ? ? -95.07 -75.58 26 10 CYS A 4 ? ? -176.09 -42.44 27 10 THR A 90 ? ? -94.85 36.60 28 11 SER A 3 ? ? -95.21 -74.97 29 11 CYS A 4 ? ? -175.67 -41.03 30 12 SER A 3 ? ? -95.63 -75.51 31 12 CYS A 4 ? ? -176.21 -40.10 32 12 THR A 90 ? ? -103.91 48.06 33 13 SER A 3 ? ? -95.14 -74.57 34 13 CYS A 4 ? ? -175.55 -40.15 35 13 TYR A 80 ? ? -113.29 -169.82 36 13 SER A 83 ? ? -175.68 -173.89 37 13 THR A 90 ? ? -94.87 44.11 38 14 SER A 3 ? ? -93.58 -75.29 39 14 CYS A 4 ? ? -175.76 -51.53 40 15 SER A 3 ? ? -95.28 -74.95 41 15 CYS A 4 ? ? -175.76 -40.43 42 16 SER A 3 ? ? -95.26 -76.07 43 16 CYS A 4 ? ? -176.81 -41.60 44 17 SER A 3 ? ? -143.05 -70.00 45 17 CYS A 4 ? ? -175.60 -40.94 46 17 SER A 83 ? ? -173.10 -179.47 47 18 SER A 3 ? ? -95.52 -75.71 48 18 CYS A 4 ? ? -176.21 -42.05 49 19 SER A 3 ? ? -95.72 -75.97 50 19 CYS A 4 ? ? -177.55 -40.91 51 20 SER A 3 ? ? -95.71 -75.11 52 20 CYS A 4 ? ? -175.75 -38.54 53 20 THR A 90 ? ? -102.35 46.77 #