data_2MAO # _entry.id 2MAO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MAO RCSB RCSB103417 BMRB 19366 WWPDB D_1000103417 # _pdbx_database_related.db_id 19366 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MAO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-07-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Campagne, S.' 1 'Vorholt, J.A.' 2 'Allain, F.H.-T.' 3 # _citation.id primary _citation.title 'Structural basis for -10 promoter element melting by environmentally induced sigma factors.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 21 _citation.page_first 269 _citation.page_last 276 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24531660 _citation.pdbx_database_id_DOI 10.1038/nsmb.2777 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Campagne, S.' 1 primary 'Marsh, M.E.' 2 primary 'Capitani, G.' 3 primary 'Vorholt, J.A.' 4 primary 'Allain, F.H.' 5 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RNA polymerase sigma factor' _entity.formula_weight 12251.906 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVN TAKNYLVAQGRRLELVPRGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVN TAKNYLVAQGRRLELVPRGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 GLN n 1 5 LEU n 1 6 THR n 1 7 ASP n 1 8 GLN n 1 9 VAL n 1 10 LEU n 1 11 VAL n 1 12 GLU n 1 13 ARG n 1 14 VAL n 1 15 GLN n 1 16 LYS n 1 17 GLY n 1 18 ASP n 1 19 GLN n 1 20 LYS n 1 21 ALA n 1 22 PHE n 1 23 ASN n 1 24 LEU n 1 25 LEU n 1 26 VAL n 1 27 VAL n 1 28 ARG n 1 29 TYR n 1 30 GLN n 1 31 HIS n 1 32 LYS n 1 33 VAL n 1 34 ALA n 1 35 SER n 1 36 LEU n 1 37 VAL n 1 38 SER n 1 39 ARG n 1 40 TYR n 1 41 VAL n 1 42 PRO n 1 43 SER n 1 44 GLY n 1 45 ASP n 1 46 VAL n 1 47 PRO n 1 48 ASP n 1 49 VAL n 1 50 VAL n 1 51 GLN n 1 52 GLU n 1 53 ALA n 1 54 PHE n 1 55 ILE n 1 56 LYS n 1 57 ALA n 1 58 TYR n 1 59 ARG n 1 60 ALA n 1 61 LEU n 1 62 ASP n 1 63 SER n 1 64 PHE n 1 65 ARG n 1 66 GLY n 1 67 ASP n 1 68 SER n 1 69 ALA n 1 70 PHE n 1 71 TYR n 1 72 THR n 1 73 TRP n 1 74 LEU n 1 75 TYR n 1 76 ARG n 1 77 ILE n 1 78 ALA n 1 79 VAL n 1 80 ASN n 1 81 THR n 1 82 ALA n 1 83 LYS n 1 84 ASN n 1 85 TYR n 1 86 LEU n 1 87 VAL n 1 88 ALA n 1 89 GLN n 1 90 GLY n 1 91 ARG n 1 92 ARG n 1 93 LEU n 1 94 GLU n 1 95 LEU n 1 96 VAL n 1 97 PRO n 1 98 ARG n 1 99 GLY n 1 100 SER n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rpoE, EcDH1_1095, ECDH1ME8569_2500' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 536056 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET26BII _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C9R146_ECOD1 _struct_ref.pdbx_db_accession C9R146 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVN TAKNYLVAQGRR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MAO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C9R146 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MAO LEU A 93 ? UNP C9R146 ? ? 'EXPRESSION TAG' 93 1 1 2MAO GLU A 94 ? UNP C9R146 ? ? 'EXPRESSION TAG' 94 2 1 2MAO LEU A 95 ? UNP C9R146 ? ? 'EXPRESSION TAG' 95 3 1 2MAO VAL A 96 ? UNP C9R146 ? ? 'EXPRESSION TAG' 96 4 1 2MAO PRO A 97 ? UNP C9R146 ? ? 'EXPRESSION TAG' 97 5 1 2MAO ARG A 98 ? UNP C9R146 ? ? 'EXPRESSION TAG' 98 6 1 2MAO GLY A 99 ? UNP C9R146 ? ? 'EXPRESSION TAG' 99 7 1 2MAO SER A 100 ? UNP C9R146 ? ? 'EXPRESSION TAG' 100 8 1 2MAO HIS A 101 ? UNP C9R146 ? ? 'EXPRESSION TAG' 101 9 1 2MAO HIS A 102 ? UNP C9R146 ? ? 'EXPRESSION TAG' 102 10 1 2MAO HIS A 103 ? UNP C9R146 ? ? 'EXPRESSION TAG' 103 11 1 2MAO HIS A 104 ? UNP C9R146 ? ? 'EXPRESSION TAG' 104 12 1 2MAO HIS A 105 ? UNP C9R146 ? ? 'EXPRESSION TAG' 105 13 1 2MAO HIS A 106 ? UNP C9R146 ? ? 'EXPRESSION TAG' 106 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.07 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker Avance 1 'Bruker Avance' 500 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MAO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MAO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MAO _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo and Kollman' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name AMBER _pdbx_nmr_software.version 9 _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR structure of region 2 of E. coli sigmaE' _exptl.entry_id 2MAO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MAO _struct.title 'NMR structure of region 2 of E. coli sigmaE' _struct.pdbx_descriptor 'RNA polymerase sigma factor' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MAO _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'ECF sigma factor, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? LYS A 16 ? THR A 6 LYS A 16 1 ? 11 HELX_P HELX_P2 2 GLN A 19 ? SER A 38 ? GLN A 19 SER A 38 1 ? 20 HELX_P HELX_P3 3 ASP A 45 ? ASP A 62 ? ASP A 45 ASP A 62 1 ? 18 HELX_P HELX_P4 4 ALA A 69 ? ARG A 91 ? ALA A 69 ARG A 91 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MAO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 HIS 106 106 106 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-02-19 2 'Structure model' 1 1 2014-02-26 3 'Structure model' 1 2 2014-03-19 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category audit_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_audit_author.name' # _pdbx_nmr_exptl_sample.component entity-1 _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 101 ? ? 49.14 24.30 2 2 LEU A 95 ? ? 53.73 19.37 3 2 HIS A 102 ? ? -142.41 11.90 4 3 SER A 2 ? ? -142.01 25.35 5 3 GLN A 4 ? ? 54.51 -172.65 6 3 HIS A 104 ? ? 55.11 -168.26 7 4 GLU A 3 ? ? 55.63 13.79 8 4 HIS A 102 ? ? 58.98 176.57 9 5 LEU A 95 ? ? 56.36 9.48 10 6 GLU A 94 ? ? -142.19 -20.27 11 7 LEU A 95 ? ? -97.44 48.79 12 8 LEU A 93 ? ? -144.90 13.28 13 8 LEU A 95 ? ? -150.17 -30.68 14 8 ARG A 98 ? ? 51.63 17.88 15 9 GLU A 3 ? ? 47.58 25.77 16 9 ARG A 65 ? ? -146.45 13.67 17 10 LEU A 93 ? ? -140.73 13.17 18 11 GLN A 4 ? ? 58.65 178.36 19 11 ASP A 67 ? ? 49.23 17.72 20 11 ALA A 69 ? ? -142.25 54.69 21 11 HIS A 103 ? ? -142.44 28.80 22 11 HIS A 104 ? ? 58.31 178.15 23 13 GLN A 4 ? ? 55.64 4.53 24 13 LEU A 93 ? ? -144.96 15.01 25 13 LEU A 95 ? ? -139.73 -35.88 26 13 HIS A 105 ? ? 58.30 177.70 27 14 HIS A 102 ? ? 55.69 18.31 28 14 HIS A 103 ? ? 55.90 -176.22 29 14 HIS A 104 ? ? 57.07 -175.74 30 14 HIS A 105 ? ? 57.29 -179.03 31 15 SER A 2 ? ? 56.09 5.68 32 15 GLU A 3 ? ? -159.65 -26.25 33 15 ARG A 65 ? ? -144.73 25.31 34 15 LEU A 95 ? ? 58.49 -23.67 35 15 HIS A 104 ? ? 49.91 22.41 36 16 GLN A 4 ? ? 56.88 7.25 37 16 ARG A 65 ? ? -140.17 13.71 38 16 ASP A 67 ? ? 47.97 22.01 39 16 SER A 68 ? ? -157.77 -8.78 40 16 ALA A 69 ? ? -142.24 54.82 41 16 LEU A 93 ? ? -141.16 -7.78 42 16 HIS A 105 ? ? 55.90 -176.14 43 17 HIS A 104 ? ? 58.98 16.73 44 18 LEU A 93 ? ? 52.36 17.19 45 18 LEU A 95 ? ? -141.86 15.98 46 18 VAL A 96 ? ? 50.06 75.60 #