data_2MAR # _entry.id 2MAR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MAR RCSB RCSB103420 BMRB 19372 WWPDB D_1000103420 # _pdbx_database_related.db_id 19372 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MAR _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-07-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Garcia-Mayoral, M.F.' 1 'Trevino, M.A.' 2 'Perez-Pinar, T.' 3 'Caballero, M.L.' 4 'Knaute, T.' 5 'Umpierrez, A.' 6 'Bruix, M.' 7 'Rodriguez-Perez, R.' 8 # _citation.id primary _citation.title ;Relationships between IgE/IgG4 epitopes, structure and function in Anisakis simplex Ani s 5, a member of the SXP/RAL-2 protein family ; _citation.journal_abbrev 'Plos Negl Trop Dis' _citation.journal_volume 8 _citation.page_first e2735 _citation.page_last e2735 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1935-2727 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24603892 _citation.pdbx_database_id_DOI 10.1371/journal.pntd.0002735 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Garcia-Mayoral, M.F.' 1 primary 'Trevino, M.A.' 2 primary 'Perez-Pinar, T.' 3 primary 'Caballero, M.L.' 4 primary 'Knaute, T.' 5 primary 'Umpierrez, A.' 6 primary 'Bruix, M.' 7 primary 'Rodriguez-Perez, R.' 8 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SXP/RAL-2 family protein' _entity.formula_weight 14759.721 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 19-152' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DDTPPPPPFLAGAPQDVVKAFFELLKKDETKTDPEIEKDLDAWVDTLGGDYKAKFETFKKEMKAKEAELAKAHEEAVAKM TPEAKKADAELSKIAEDDSLNGIQKAQKIQAIYKTLPQSVKDELEKGIGPAVPQ ; _entity_poly.pdbx_seq_one_letter_code_can ;DDTPPPPPFLAGAPQDVVKAFFELLKKDETKTDPEIEKDLDAWVDTLGGDYKAKFETFKKEMKAKEAELAKAHEEAVAKM TPEAKKADAELSKIAEDDSLNGIQKAQKIQAIYKTLPQSVKDELEKGIGPAVPQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 THR n 1 4 PRO n 1 5 PRO n 1 6 PRO n 1 7 PRO n 1 8 PRO n 1 9 PHE n 1 10 LEU n 1 11 ALA n 1 12 GLY n 1 13 ALA n 1 14 PRO n 1 15 GLN n 1 16 ASP n 1 17 VAL n 1 18 VAL n 1 19 LYS n 1 20 ALA n 1 21 PHE n 1 22 PHE n 1 23 GLU n 1 24 LEU n 1 25 LEU n 1 26 LYS n 1 27 LYS n 1 28 ASP n 1 29 GLU n 1 30 THR n 1 31 LYS n 1 32 THR n 1 33 ASP n 1 34 PRO n 1 35 GLU n 1 36 ILE n 1 37 GLU n 1 38 LYS n 1 39 ASP n 1 40 LEU n 1 41 ASP n 1 42 ALA n 1 43 TRP n 1 44 VAL n 1 45 ASP n 1 46 THR n 1 47 LEU n 1 48 GLY n 1 49 GLY n 1 50 ASP n 1 51 TYR n 1 52 LYS n 1 53 ALA n 1 54 LYS n 1 55 PHE n 1 56 GLU n 1 57 THR n 1 58 PHE n 1 59 LYS n 1 60 LYS n 1 61 GLU n 1 62 MET n 1 63 LYS n 1 64 ALA n 1 65 LYS n 1 66 GLU n 1 67 ALA n 1 68 GLU n 1 69 LEU n 1 70 ALA n 1 71 LYS n 1 72 ALA n 1 73 HIS n 1 74 GLU n 1 75 GLU n 1 76 ALA n 1 77 VAL n 1 78 ALA n 1 79 LYS n 1 80 MET n 1 81 THR n 1 82 PRO n 1 83 GLU n 1 84 ALA n 1 85 LYS n 1 86 LYS n 1 87 ALA n 1 88 ASP n 1 89 ALA n 1 90 GLU n 1 91 LEU n 1 92 SER n 1 93 LYS n 1 94 ILE n 1 95 ALA n 1 96 GLU n 1 97 ASP n 1 98 ASP n 1 99 SER n 1 100 LEU n 1 101 ASN n 1 102 GLY n 1 103 ILE n 1 104 GLN n 1 105 LYS n 1 106 ALA n 1 107 GLN n 1 108 LYS n 1 109 ILE n 1 110 GLN n 1 111 ALA n 1 112 ILE n 1 113 TYR n 1 114 LYS n 1 115 THR n 1 116 LEU n 1 117 PRO n 1 118 GLN n 1 119 SER n 1 120 VAL n 1 121 LYS n 1 122 ASP n 1 123 GLU n 1 124 LEU n 1 125 GLU n 1 126 LYS n 1 127 GLY n 1 128 ILE n 1 129 GLY n 1 130 PRO n 1 131 ALA n 1 132 VAL n 1 133 PRO n 1 134 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Herring worm' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ani s 5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anisakis simplex' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6269 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET46 EK/LIC' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A1IKL2_ANISI _struct_ref.pdbx_db_accession A1IKL2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DDTPPPPPFLAGAPQDVVKAFFELLKKDETKTDPEIEKDLDAWVDTLGGDYKAKFETFKKEMKAKEAELAKAHEEAVAKM TPEAKKADAELSKIAEDDSLNGIQKAQKIQAIYKTLPQSVKDELEKGIGPAVPQ ; _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MAR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A1IKL2 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '2D 1H-13C HSQC aromatic' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-15N TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5 mM [U-13C; U-15N] Ani s 5-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MAR _pdbx_nmr_refine.method 'torsion angle dynamics, energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MAR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MAR _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 2.1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement AMBER 2 9 ? refinement CYANA 3 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MAR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MAR _struct.title 'Solution structure of Ani s 5 Anisakis simplex allergen' _struct.pdbx_descriptor 'SXP/RAL-2 family protein' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MAR _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 14 ? ASP A 28 ? PRO A 14 ASP A 28 1 ? 15 HELX_P HELX_P2 2 THR A 32 ? ASP A 45 ? THR A 32 ASP A 45 1 ? 14 HELX_P HELX_P3 3 ASP A 50 ? ALA A 78 ? ASP A 50 ALA A 78 1 ? 29 HELX_P HELX_P4 4 THR A 81 ? ASP A 97 ? THR A 81 ASP A 97 1 ? 17 HELX_P HELX_P5 5 GLY A 102 ? LYS A 114 ? GLY A 102 LYS A 114 1 ? 13 HELX_P HELX_P6 6 PRO A 117 ? LYS A 126 ? PRO A 117 LYS A 126 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MAR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLN 134 134 134 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-07-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_nmr_exptl_sample.component 'Ani s 5-1' _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 10 ? ? -95.86 41.87 2 1 LEU A 116 ? ? -109.36 75.89 3 2 ASP A 2 ? ? -153.03 -65.69 4 2 ALA A 11 ? ? -35.36 105.59 5 2 ASP A 50 ? ? 71.20 -3.12 6 2 ASP A 97 ? ? -156.63 78.40 7 2 ILE A 128 ? ? -148.74 54.10 8 2 ALA A 131 ? ? 59.80 108.14 9 2 VAL A 132 ? ? -116.23 72.83 10 3 MET A 80 ? ? -90.24 -84.68 11 3 ASP A 97 ? ? -157.83 79.88 12 3 LEU A 116 ? ? -109.15 72.31 13 4 ALA A 11 ? ? -34.49 101.50 14 4 LEU A 116 ? ? -44.75 151.16 15 5 LEU A 10 ? ? -93.40 35.44 16 5 MET A 80 ? ? -102.30 -160.30 17 6 LEU A 10 ? ? -91.56 38.77 18 6 MET A 80 ? ? -103.25 -159.27 19 6 LEU A 116 ? ? -108.04 74.86 20 6 ILE A 128 ? ? -118.98 64.93 21 7 ASP A 50 ? ? 69.70 -1.94 22 7 ILE A 128 ? ? 29.37 60.40 23 7 ALA A 131 ? ? -161.94 116.24 24 8 ALA A 11 ? ? -35.36 104.52 25 8 MET A 80 ? ? -106.31 -163.55 26 8 ILE A 128 ? ? -143.22 49.21 27 9 ASP A 2 ? ? -158.69 55.47 28 9 LEU A 47 ? ? -66.25 -71.21 29 9 MET A 80 ? ? -86.56 -83.86 30 9 LEU A 116 ? ? -114.69 71.29 31 9 ALA A 131 ? ? 57.28 107.47 32 9 VAL A 132 ? ? -107.22 79.30 33 10 ALA A 11 ? ? -15.48 99.12 34 10 LYS A 31 ? ? -56.09 171.95 35 10 MET A 80 ? ? -97.43 -77.02 36 10 THR A 115 ? ? -98.93 44.22 37 10 ILE A 128 ? ? -151.16 54.93 38 10 PRO A 133 ? ? -73.06 -169.26 39 11 ALA A 11 ? ? -40.32 107.62 40 11 MET A 80 ? ? -93.44 -80.55 41 11 ILE A 128 ? ? -117.16 63.40 42 11 ALA A 131 ? ? 57.29 100.78 43 11 VAL A 132 ? ? -119.20 74.59 44 12 MET A 80 ? ? -88.23 -85.73 45 12 ILE A 128 ? ? -140.26 56.82 46 12 ALA A 131 ? ? 57.92 97.13 47 13 ASP A 2 ? ? -148.83 -74.92 48 13 ALA A 11 ? ? -37.60 104.19 49 13 MET A 80 ? ? -103.88 -159.02 50 13 LEU A 116 ? ? -111.71 72.05 51 13 ILE A 128 ? ? -114.00 61.70 52 13 VAL A 132 ? ? -119.00 75.98 53 14 ASP A 50 ? ? 74.18 -6.25 54 14 MET A 80 ? ? -105.35 -161.62 55 14 ASP A 97 ? ? -164.79 78.06 56 14 ALA A 131 ? ? -159.81 71.98 57 15 ALA A 11 ? ? -35.34 106.71 58 15 MET A 80 ? ? -90.85 -81.37 59 15 ILE A 128 ? ? -114.69 66.91 60 16 ALA A 11 ? ? -38.49 105.37 61 16 MET A 80 ? ? -95.26 -159.22 62 17 ALA A 11 ? ? -44.89 109.82 63 17 ALA A 131 ? ? 47.69 80.58 64 18 ASP A 2 ? ? -150.17 87.34 65 18 MET A 80 ? ? -94.57 -159.82 66 19 ALA A 11 ? ? -33.25 103.61 67 19 MET A 80 ? ? -103.53 -158.57 68 19 ILE A 128 ? ? 37.44 52.51 69 20 ASP A 2 ? ? 51.70 -153.38 70 20 ALA A 11 ? ? -32.92 104.52 71 20 MET A 80 ? ? -103.00 -159.64 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 16 _pdbx_validate_main_chain_plane.auth_comp_id ALA _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 111 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.05 #