data_2MB7 # _entry.id 2MB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MB7 pdb_00002mb7 10.2210/pdb2mb7/pdb RCSB RCSB103433 ? ? BMRB 19391 ? ? WWPDB D_1000103433 ? ? # _pdbx_database_related.db_id 19391 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MB7 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-07-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Williams Jr., D.C.' 1 'Scarsdale, J.N.' 2 # _citation.id primary _citation.title 'Probing the Dynamic Distribution of Bound States for Methylcytosine-binding Domains on DNA.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 1294 _citation.page_last 1302 _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24307175 _citation.pdbx_database_id_DOI 10.1074/jbc.M113.512236 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cramer, J.M.' 1 ? primary 'Scarsdale, J.N.' 2 ? primary 'Walavalkar, N.M.' 3 ? primary 'Buchwald, W.A.' 4 ? primary 'Ginder, G.D.' 5 ? primary 'Williams, D.C.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Methyl-CpG-binding domain protein 3' _entity.formula_weight 8342.521 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Methyl-CpG-binding domain (UNP residues 1-70)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Methyl-CpG-binding protein MBD3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML _entity_poly.pdbx_seq_one_letter_code_can GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLU n 1 5 ARG n 1 6 LYS n 1 7 ARG n 1 8 TRP n 1 9 GLU n 1 10 CYS n 1 11 PRO n 1 12 ALA n 1 13 LEU n 1 14 PRO n 1 15 GLN n 1 16 GLY n 1 17 TRP n 1 18 GLU n 1 19 ARG n 1 20 GLU n 1 21 GLU n 1 22 VAL n 1 23 PRO n 1 24 ARG n 1 25 ARG n 1 26 SER n 1 27 GLY n 1 28 LEU n 1 29 SER n 1 30 ALA n 1 31 GLY n 1 32 HIS n 1 33 ARG n 1 34 ASP n 1 35 VAL n 1 36 PHE n 1 37 TYR n 1 38 TYR n 1 39 SER n 1 40 PRO n 1 41 SER n 1 42 GLY n 1 43 LYS n 1 44 LYS n 1 45 PHE n 1 46 ARG n 1 47 SER n 1 48 LYS n 1 49 PRO n 1 50 GLN n 1 51 LEU n 1 52 ALA n 1 53 ARG n 1 54 TYR n 1 55 LEU n 1 56 GLY n 1 57 GLY n 1 58 SER n 1 59 MET n 1 60 ASP n 1 61 LEU n 1 62 SER n 1 63 THR n 1 64 PHE n 1 65 ASP n 1 66 PHE n 1 67 ARG n 1 68 THR n 1 69 GLY n 1 70 LYS n 1 71 MET n 1 72 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MBD3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MBD3_HUMAN _struct_ref.pdbx_db_accession O95983 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MB7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95983 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MB7 GLY A 1 ? UNP O95983 ? ? 'expression tag' 1 1 1 2MB7 SER A 2 ? UNP O95983 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5-1.0 mM [U-99% 13C; U-99% 15N] MBD3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MB7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MB7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.8 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.48 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MB7 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Vranken, Boucher, Stevens, Fogh, Pajon, Llinas, Ulrich, Markley, Ionides, and Laue' 'data analysis' CCPN ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MB7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MB7 _struct.title 'Solution structure of MBD3 methylcytosine binding domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MB7 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'MBD3, DNA methylation, NuRD, chromatin, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 8 ? GLU A 9 ? TRP A 8 GLU A 9 A 2 GLU A 18 ? SER A 26 ? GLU A 18 SER A 26 A 3 SER A 29 ? TYR A 38 ? SER A 29 TYR A 38 A 4 LYS A 44 ? PHE A 45 ? LYS A 44 PHE A 45 B 1 PHE A 64 ? ASP A 65 ? PHE A 64 ASP A 65 B 2 LYS A 70 ? MET A 71 ? LYS A 70 MET A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 8 ? N TRP A 8 O ARG A 19 ? O ARG A 19 A 2 3 N ARG A 24 ? N ARG A 24 O HIS A 32 ? O HIS A 32 A 3 4 N TYR A 37 ? N TYR A 37 O PHE A 45 ? O PHE A 45 B 1 2 N ASP A 65 ? N ASP A 65 O LYS A 70 ? O LYS A 70 # _atom_sites.entry_id 2MB7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 LEU 72 72 72 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-12-11 2 'Structure model' 1 1 2014-01-01 3 'Structure model' 1 2 2014-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.018 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.003 _pdbx_nmr_ensemble_rms.entry_id 2MB7 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_exptl_sample.component MBD3-1 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.5-1.0 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MB7 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 528 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 102 _pdbx_nmr_constraints.NOE_long_range_total_count 160 _pdbx_nmr_constraints.NOE_medium_range_total_count 111 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 155 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 12 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 54 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 54 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 O A GLY 56 ? ? H A SER 58 ? ? 1.39 2 7 H A ASP 65 ? ? O A LYS 70 ? ? 1.59 3 9 HE A ARG 5 ? ? OE2 A GLU 20 ? ? 1.56 4 11 HE1 A TRP 8 ? ? H A GLU 21 ? ? 1.19 5 14 HE A ARG 24 ? ? OD2 A ASP 34 ? ? 1.56 6 15 O A LEU 55 ? ? H A MET 59 ? ? 1.60 7 17 O A GLY 56 ? ? H A SER 58 ? ? 1.48 8 17 O A GLY 56 ? ? N A SER 58 ? ? 2.02 9 18 O A ALA 52 ? ? H A GLY 56 ? ? 1.56 10 19 HE A ARG 24 ? ? H A ARG 25 ? ? 1.26 11 19 H A ASP 65 ? ? O A LYS 70 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 25 ? ? -152.54 35.20 2 1 SER A 29 ? ? -69.73 16.38 3 1 MET A 59 ? ? 179.50 173.38 4 2 PRO A 14 ? ? -49.72 155.75 5 2 ALA A 30 ? ? -44.03 170.39 6 3 SER A 2 ? ? 48.10 90.34 7 3 ARG A 5 ? ? 60.87 75.15 8 3 SER A 26 ? ? 55.78 164.48 9 3 LEU A 28 ? ? -58.03 -0.51 10 4 SER A 2 ? ? -125.47 -65.02 11 4 ARG A 5 ? ? -51.73 178.65 12 4 SER A 29 ? ? -76.08 22.55 13 4 ARG A 46 ? ? -124.58 -72.54 14 4 SER A 47 ? ? -21.26 130.41 15 5 ARG A 5 ? ? 54.02 106.61 16 5 ALA A 30 ? ? -34.92 155.21 17 6 ARG A 25 ? ? -135.01 -33.82 18 6 ALA A 30 ? ? -38.94 131.37 19 6 MET A 59 ? ? 169.45 126.88 20 6 THR A 63 ? ? -94.71 35.14 21 7 SER A 2 ? ? 50.24 93.32 22 7 ARG A 5 ? ? 55.17 110.90 23 7 GLN A 15 ? ? -49.93 106.80 24 7 ARG A 24 ? ? -57.38 90.13 25 7 ARG A 25 ? ? -56.25 -75.18 26 7 SER A 26 ? ? -162.37 58.57 27 7 ALA A 30 ? ? -42.76 170.62 28 7 HIS A 32 ? ? -133.11 -146.06 29 8 ALA A 30 ? ? -34.22 152.64 30 9 SER A 2 ? ? 67.16 -29.06 31 9 ARG A 25 ? ? -144.53 -31.44 32 9 SER A 29 ? ? -77.27 26.33 33 9 ALA A 30 ? ? -33.01 150.71 34 9 MET A 59 ? ? 178.10 171.25 35 9 THR A 63 ? ? -95.35 49.65 36 10 GLN A 15 ? ? -44.64 107.17 37 10 SER A 26 ? ? -34.41 -94.54 38 10 ALA A 30 ? ? -39.07 132.58 39 10 HIS A 32 ? ? -57.29 102.10 40 11 SER A 2 ? ? -65.90 -72.46 41 11 ARG A 5 ? ? 60.13 105.53 42 11 LEU A 13 ? ? -40.70 157.49 43 11 ARG A 25 ? ? -167.27 19.18 44 11 SER A 26 ? ? -149.37 -43.40 45 11 ALA A 30 ? ? -42.39 169.68 46 11 ARG A 46 ? ? -130.77 -66.71 47 11 SER A 47 ? ? -15.82 125.91 48 12 SER A 2 ? ? 51.33 103.31 49 12 GLU A 4 ? ? -142.99 -157.52 50 12 ARG A 25 ? ? -170.33 -9.20 51 12 ALA A 30 ? ? -35.89 152.82 52 12 THR A 63 ? ? -98.57 48.39 53 13 MET A 3 ? ? 41.04 -157.83 54 13 SER A 29 ? ? -70.96 21.92 55 13 ARG A 46 ? ? -141.70 59.78 56 14 SER A 2 ? ? -148.15 -157.69 57 14 ARG A 5 ? ? 31.51 95.12 58 14 SER A 26 ? ? 4.27 -112.17 59 15 MET A 3 ? ? 46.18 -144.88 60 15 GLU A 4 ? ? -93.26 34.58 61 15 ARG A 5 ? ? 57.45 139.55 62 15 ARG A 25 ? ? -119.06 -139.18 63 15 SER A 26 ? ? -38.14 166.06 64 15 SER A 29 ? ? -70.78 30.38 65 16 MET A 3 ? ? 50.90 -169.80 66 16 GLU A 4 ? ? 42.65 88.16 67 16 ARG A 5 ? ? -71.21 -110.30 68 16 ARG A 25 ? ? -174.44 62.88 69 16 SER A 26 ? ? 168.32 78.75 70 16 SER A 29 ? ? -70.39 29.67 71 16 THR A 63 ? ? -95.23 45.68 72 17 GLU A 4 ? ? 41.12 27.61 73 17 ARG A 24 ? ? -59.86 87.88 74 17 SER A 26 ? ? 63.49 139.70 75 17 ALA A 30 ? ? -42.50 170.43 76 17 HIS A 32 ? ? -127.52 -162.27 77 18 ARG A 5 ? ? -163.68 112.56 78 19 SER A 26 ? ? -179.17 -67.93 79 19 THR A 63 ? ? -94.60 39.67 80 20 GLU A 4 ? ? 29.01 86.60 81 20 LEU A 55 ? ? -64.23 1.20 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 72 ? O ? A LEU 72 O 2 2 Y 1 A LEU 72 ? O ? A LEU 72 O 3 3 Y 1 A LEU 72 ? O ? A LEU 72 O 4 4 Y 1 A LEU 72 ? O ? A LEU 72 O 5 5 Y 1 A LEU 72 ? O ? A LEU 72 O 6 6 Y 1 A LEU 72 ? O ? A LEU 72 O 7 7 Y 1 A LEU 72 ? O ? A LEU 72 O 8 8 Y 1 A LEU 72 ? O ? A LEU 72 O 9 9 Y 1 A LEU 72 ? O ? A LEU 72 O 10 10 Y 1 A LEU 72 ? O ? A LEU 72 O 11 11 Y 1 A LEU 72 ? O ? A LEU 72 O 12 12 Y 1 A LEU 72 ? O ? A LEU 72 O 13 13 Y 1 A LEU 72 ? O ? A LEU 72 O 14 14 Y 1 A LEU 72 ? O ? A LEU 72 O 15 15 Y 1 A LEU 72 ? O ? A LEU 72 O 16 16 Y 1 A LEU 72 ? O ? A LEU 72 O 17 17 Y 1 A LEU 72 ? O ? A LEU 72 O 18 18 Y 1 A LEU 72 ? O ? A LEU 72 O 19 19 Y 1 A LEU 72 ? O ? A LEU 72 O 20 20 Y 1 A LEU 72 ? O ? A LEU 72 O #