data_2MBK # _entry.id 2MBK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MBK pdb_00002mbk 10.2210/pdb2mbk/pdb RCSB RCSB103445 ? ? BMRB 19403 ? 10.13018/BMR19403 WWPDB D_1000103445 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-16 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_entry_details 10 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MBK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-08-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19403 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mueller, T.D.' 1 'Fiebig, J.E.' 2 'Weidauer, S.E.' 3 'Qiu, L.' 4 'Bauer, M.' 5 'Schmieder, P.' 6 'Beerbaum, M.' 7 'Zhang, J.' 8 'Oschkinat, H.' 9 'Sebald, W.' 10 # _citation.id primary _citation.title 'The Clip-Segment of the von Willebrand Domain 1 of the BMP Modulator Protein Crossveinless 2 Is Preformed.' _citation.journal_abbrev Molecules _citation.journal_volume 18 _citation.page_first 11658 _citation.page_last 11682 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country CH _citation.journal_id_ISSN 1420-3049 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24071977 _citation.pdbx_database_id_DOI 10.3390/molecules181011658 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fiebig, J.E.' 1 ? primary 'Weidauer, S.E.' 2 ? primary 'Qiu, L.Y.' 3 ? primary 'Bauer, M.' 4 ? primary 'Schmieder, P.' 5 ? primary 'Beerbaum, M.' 6 ? primary 'Zhang, J.L.' 7 ? primary 'Oschkinat, H.' 8 ? primary 'Sebald, W.' 9 ? primary 'Mueller, T.D.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Crossveinless 2' _entity.formula_weight 7336.424 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 28-93' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSWLITGTEASCENEGEVLHIPNITDNPCISCVCLNQKAECKQEKCAPLAEDCALVVKQTGACCEKCKG _entity_poly.pdbx_seq_one_letter_code_can GSWLITGTEASCENEGEVLHIPNITDNPCISCVCLNQKAECKQEKCAPLAEDCALVVKQTGACCEKCKG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 TRP n 1 4 LEU n 1 5 ILE n 1 6 THR n 1 7 GLY n 1 8 THR n 1 9 GLU n 1 10 ALA n 1 11 SER n 1 12 CYS n 1 13 GLU n 1 14 ASN n 1 15 GLU n 1 16 GLY n 1 17 GLU n 1 18 VAL n 1 19 LEU n 1 20 HIS n 1 21 ILE n 1 22 PRO n 1 23 ASN n 1 24 ILE n 1 25 THR n 1 26 ASP n 1 27 ASN n 1 28 PRO n 1 29 CYS n 1 30 ILE n 1 31 SER n 1 32 CYS n 1 33 VAL n 1 34 CYS n 1 35 LEU n 1 36 ASN n 1 37 GLN n 1 38 LYS n 1 39 ALA n 1 40 GLU n 1 41 CYS n 1 42 LYS n 1 43 GLN n 1 44 GLU n 1 45 LYS n 1 46 CYS n 1 47 ALA n 1 48 PRO n 1 49 LEU n 1 50 ALA n 1 51 GLU n 1 52 ASP n 1 53 CYS n 1 54 ALA n 1 55 LEU n 1 56 VAL n 1 57 VAL n 1 58 LYS n 1 59 GLN n 1 60 THR n 1 61 GLY n 1 62 ALA n 1 63 CYS n 1 64 CYS n 1 65 GLU n 1 66 LYS n 1 67 CYS n 1 68 LYS n 1 69 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'zebra fish' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'bmper, cvl2, id:ibd5071' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 TRP 3 -1 -1 TRP TRP A . n A 1 4 LEU 4 1 1 LEU LEU A . n A 1 5 ILE 5 2 2 ILE ILE A . n A 1 6 THR 6 3 3 THR THR A . n A 1 7 GLY 7 4 4 GLY GLY A . n A 1 8 THR 8 5 5 THR THR A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 SER 11 8 8 SER SER A . n A 1 12 CYS 12 9 9 CYS CYS A . n A 1 13 GLU 13 10 10 GLU GLU A . n A 1 14 ASN 14 11 11 ASN ASN A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 GLU 17 14 14 GLU GLU A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 ILE 21 18 18 ILE ILE A . n A 1 22 PRO 22 19 19 PRO PRO A . n A 1 23 ASN 23 20 20 ASN ASN A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 THR 25 22 22 THR THR A . n A 1 26 ASP 26 23 23 ASP ASP A . n A 1 27 ASN 27 24 24 ASN ASN A . n A 1 28 PRO 28 25 25 PRO PRO A . n A 1 29 CYS 29 26 26 CYS CYS A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 CYS 32 29 29 CYS CYS A . n A 1 33 VAL 33 30 30 VAL VAL A . n A 1 34 CYS 34 31 31 CYS CYS A . n A 1 35 LEU 35 32 32 LEU LEU A . n A 1 36 ASN 36 33 33 ASN ASN A . n A 1 37 GLN 37 34 34 GLN GLN A . n A 1 38 LYS 38 35 35 LYS LYS A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 GLU 40 37 37 GLU GLU A . n A 1 41 CYS 41 38 38 CYS CYS A . n A 1 42 LYS 42 39 39 LYS LYS A . n A 1 43 GLN 43 40 40 GLN GLN A . n A 1 44 GLU 44 41 41 GLU GLU A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 CYS 46 43 43 CYS CYS A . n A 1 47 ALA 47 44 44 ALA ALA A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 GLU 51 48 48 GLU GLU A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 CYS 53 50 50 CYS CYS A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 GLN 59 56 56 GLN GLN A . n A 1 60 THR 60 57 57 THR THR A . n A 1 61 GLY 61 58 58 GLY GLY A . n A 1 62 ALA 62 59 59 ALA ALA A . n A 1 63 CYS 63 60 60 CYS CYS A . n A 1 64 CYS 64 61 61 CYS CYS A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 CYS 67 64 64 CYS CYS A . n A 1 68 LYS 68 65 65 LYS LYS A . n A 1 69 GLY 69 66 66 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MBK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MBK _struct.title 'The Clip-segment of the von Willebrand domain 1 of the BMP modulator protein Crossveinless 2 is preformed' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MBK _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'von Willebrand type C domain, BMP modulator, Crossveinless 2, BMPER, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5D734_DANRE _struct_ref.pdbx_db_accession Q5D734 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LITGTEASCENEGEVLHIPNITDNPCISCVCLNQKAECKQEKCAPLAEDCALVVKQTGACCEKCKG _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MBK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5D734 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MBK GLY A 1 ? UNP Q5D734 ? ? 'expression tag' -3 1 1 2MBK SER A 2 ? UNP Q5D734 ? ? 'expression tag' -2 2 1 2MBK TRP A 3 ? UNP Q5D734 ? ? 'expression tag' -1 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 18 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 9 A CYS 31 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 63 SG ? ? A CYS 26 A CYS 60 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 29 A CYS 38 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf4 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 43 A CYS 61 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf5 disulf ? ? A CYS 53 SG ? ? ? 1_555 A CYS 67 SG ? ? A CYS 50 A CYS 64 1_555 ? ? ? ? ? ? ? 2.017 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 12 ? CYS A 34 ? CYS A 9 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 29 ? CYS A 63 ? CYS A 26 ? 1_555 CYS A 60 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 32 ? CYS A 41 ? CYS A 29 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 46 ? CYS A 64 ? CYS A 43 ? 1_555 CYS A 61 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 53 ? CYS A 67 ? CYS A 50 ? 1_555 CYS A 64 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 30 ? SER A 31 ? ILE A 27 SER A 28 A 2 LYS A 42 ? GLN A 43 ? LYS A 39 GLN A 40 B 1 CYS A 34 ? LEU A 35 ? CYS A 31 LEU A 32 B 2 LYS A 38 ? ALA A 39 ? LYS A 35 ALA A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 31 ? N SER A 28 O LYS A 42 ? O LYS A 39 B 1 2 N LEU A 35 ? N LEU A 32 O LYS A 38 ? O LYS A 35 # _pdbx_entry_details.entry_id 2MBK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 30 ? ? H A GLU 37 ? ? 1.55 2 1 H A GLY 13 ? ? O A CYS 31 ? ? 1.59 3 2 H A LEU 32 ? ? O A LYS 35 ? ? 1.54 4 2 O A ILE 18 ? ? HG1 A THR 22 ? ? 1.56 5 2 H A GLY 13 ? ? O A CYS 31 ? ? 1.57 6 2 O A VAL 30 ? ? H A GLU 37 ? ? 1.57 7 3 H A LEU 52 ? ? O A LYS 63 ? ? 1.45 8 3 H A ALA 51 ? ? O A LYS 63 ? ? 1.50 9 3 O A VAL 30 ? ? H A GLU 37 ? ? 1.57 10 3 H A GLY 13 ? ? O A CYS 31 ? ? 1.57 11 3 H A LEU 32 ? ? O A LYS 35 ? ? 1.57 12 4 H A LEU 32 ? ? O A LYS 35 ? ? 1.53 13 4 O A ALA 7 ? ? H A ALA 36 ? ? 1.55 14 4 O A VAL 30 ? ? H A GLU 37 ? ? 1.57 15 4 H A LEU 16 ? ? O A CYS 29 ? ? 1.57 16 4 O A ASN 24 ? ? H A ILE 27 ? ? 1.58 17 4 H A GLY 13 ? ? O A CYS 31 ? ? 1.58 18 4 H A VAL 30 ? ? O A GLU 37 ? ? 1.58 19 5 O A VAL 30 ? ? H A GLU 37 ? ? 1.54 20 5 H A GLY 13 ? ? O A CYS 31 ? ? 1.54 21 5 O A ASN 24 ? ? H A ILE 27 ? ? 1.56 22 5 H A LEU 32 ? ? O A LYS 35 ? ? 1.56 23 5 H A LEU 16 ? ? O A CYS 29 ? ? 1.58 24 5 H A VAL 30 ? ? O A GLU 37 ? ? 1.59 25 6 HA A ALA 47 ? ? HB3 A CYS 50 ? ? 1.29 26 6 H A GLY 13 ? ? O A CYS 31 ? ? 1.54 27 6 O A VAL 30 ? ? H A GLU 37 ? ? 1.57 28 7 H A LEU 52 ? ? O A LYS 63 ? ? 1.46 29 7 O A LEU 52 ? ? H A VAL 54 ? ? 1.53 30 7 O A VAL 30 ? ? H A GLU 37 ? ? 1.54 31 7 H A GLY 13 ? ? O A CYS 31 ? ? 1.55 32 7 H A LEU 32 ? ? O A LYS 35 ? ? 1.57 33 7 H A LEU 16 ? ? O A CYS 29 ? ? 1.57 34 7 H A VAL 30 ? ? O A GLU 37 ? ? 1.58 35 8 H A GLY 13 ? ? O A CYS 31 ? ? 1.49 36 8 H A LEU 32 ? ? O A LYS 35 ? ? 1.57 37 8 O A VAL 30 ? ? H A GLU 37 ? ? 1.57 38 8 H A LEU 16 ? ? O A CYS 29 ? ? 1.58 39 9 O A ALA 47 ? ? H A CYS 50 ? ? 1.47 40 9 H A GLY 13 ? ? O A CYS 31 ? ? 1.50 41 9 O A VAL 30 ? ? H A GLU 37 ? ? 1.52 42 10 H A LEU 32 ? ? O A LYS 35 ? ? 1.53 43 10 O A VAL 30 ? ? H A GLU 37 ? ? 1.54 44 10 H A VAL 30 ? ? O A GLU 37 ? ? 1.57 45 10 O A ASN 24 ? ? H A ILE 27 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 14 ? ? -110.51 -91.17 2 1 VAL A 15 ? ? 174.51 136.61 3 1 PRO A 19 ? ? -51.63 -86.16 4 1 ILE A 21 ? ? -93.72 -74.21 5 1 CYS A 31 ? ? -54.63 78.08 6 1 LEU A 46 ? ? -119.52 -71.59 7 1 GLU A 48 ? ? 90.59 -38.29 8 1 CYS A 50 ? ? -41.41 150.75 9 1 LEU A 52 ? ? 65.49 86.35 10 1 LYS A 55 ? ? 164.05 133.69 11 1 CYS A 60 ? ? -69.57 -80.54 12 1 CYS A 61 ? ? -48.92 165.23 13 1 LYS A 65 ? ? 133.23 -3.46 14 2 CYS A 9 ? ? -118.73 -166.68 15 2 ASN A 11 ? ? -121.41 -126.28 16 2 VAL A 15 ? ? 45.15 108.04 17 2 PRO A 19 ? ? -48.27 -88.44 18 2 CYS A 31 ? ? -50.08 83.94 19 2 GLU A 37 ? ? -63.83 91.30 20 2 LEU A 46 ? ? -112.36 -147.99 21 2 GLU A 48 ? ? 83.99 -4.49 22 2 ALA A 51 ? ? -154.93 30.57 23 2 VAL A 53 ? ? 162.21 -34.02 24 2 LYS A 63 ? ? -105.25 -137.42 25 2 LYS A 65 ? ? 120.04 9.92 26 3 ASN A 11 ? ? -110.97 -131.35 27 3 GLU A 14 ? ? -101.87 -75.05 28 3 VAL A 15 ? ? 155.66 107.30 29 3 PRO A 19 ? ? -52.71 -85.12 30 3 ILE A 21 ? ? -94.50 -74.53 31 3 CYS A 31 ? ? -55.34 90.12 32 3 ALA A 44 ? ? -46.50 -173.37 33 3 PRO A 45 ? ? -31.74 155.64 34 3 ALA A 47 ? ? 86.36 -158.06 35 3 GLU A 48 ? ? 56.59 15.07 36 3 ASP A 49 ? ? 137.98 33.39 37 3 ALA A 51 ? ? -162.34 15.29 38 3 LEU A 52 ? ? 149.57 77.80 39 3 VAL A 53 ? ? -39.29 77.08 40 3 VAL A 54 ? ? 95.74 113.97 41 3 GLN A 56 ? ? 47.01 103.09 42 3 ALA A 59 ? ? -73.63 -82.36 43 3 CYS A 60 ? ? -151.71 -76.48 44 3 CYS A 61 ? ? 179.88 -162.56 45 3 GLU A 62 ? ? -170.27 -142.71 46 3 CYS A 64 ? ? 7.30 125.09 47 3 LYS A 65 ? ? -80.04 48.66 48 4 CYS A 9 ? ? -105.58 -168.10 49 4 ASN A 11 ? ? -115.40 -125.15 50 4 VAL A 15 ? ? 48.70 111.20 51 4 PRO A 19 ? ? -59.46 -88.79 52 4 ASN A 20 ? ? -38.24 -26.80 53 4 ILE A 21 ? ? -98.95 -77.88 54 4 CYS A 31 ? ? -50.58 83.58 55 4 ALA A 36 ? ? -67.86 86.23 56 4 GLU A 37 ? ? -64.55 94.84 57 4 LEU A 46 ? ? -130.63 -72.35 58 4 GLU A 48 ? ? 84.56 -20.91 59 4 CYS A 50 ? ? -53.05 -152.60 60 4 ALA A 51 ? ? 148.58 -6.10 61 4 LEU A 52 ? ? 162.52 176.11 62 4 VAL A 53 ? ? 152.74 -25.77 63 4 LYS A 63 ? ? -50.71 -114.36 64 4 CYS A 64 ? ? 165.74 146.97 65 4 LYS A 65 ? ? 154.87 19.76 66 5 ALA A 7 ? ? 39.19 91.17 67 5 CYS A 9 ? ? -114.21 -166.03 68 5 ASN A 11 ? ? -111.80 -130.27 69 5 GLU A 12 ? ? -161.76 118.11 70 5 GLU A 14 ? ? -101.26 -75.82 71 5 VAL A 15 ? ? 156.15 107.43 72 5 ASN A 20 ? ? 80.75 -29.45 73 5 ILE A 21 ? ? -89.09 -73.21 74 5 CYS A 31 ? ? -52.78 84.09 75 5 LEU A 46 ? ? -142.35 -144.93 76 5 ALA A 47 ? ? 133.94 -150.09 77 5 GLU A 48 ? ? 52.11 17.28 78 5 ASP A 49 ? ? 173.65 -33.32 79 5 VAL A 54 ? ? 63.73 116.73 80 5 GLN A 56 ? ? 51.83 104.20 81 5 CYS A 61 ? ? 172.24 156.22 82 5 GLU A 62 ? ? -138.46 -61.25 83 5 LYS A 63 ? ? 61.07 170.26 84 5 CYS A 64 ? ? -36.02 155.60 85 5 LYS A 65 ? ? -155.95 15.12 86 6 ALA A 7 ? ? 101.61 124.43 87 6 VAL A 15 ? ? 100.13 139.01 88 6 LEU A 16 ? ? -154.87 87.46 89 6 ASN A 20 ? ? 80.92 -38.14 90 6 ILE A 21 ? ? -87.42 -74.87 91 6 CYS A 31 ? ? -47.37 74.78 92 6 GLU A 37 ? ? -68.98 64.36 93 6 LEU A 46 ? ? -69.88 -175.66 94 6 ALA A 47 ? ? 170.03 -171.88 95 6 GLU A 48 ? ? 112.44 -12.83 96 6 ASP A 49 ? ? -173.28 30.13 97 6 CYS A 50 ? ? -98.88 -158.78 98 6 ALA A 51 ? ? 144.29 -7.54 99 6 LEU A 52 ? ? 160.56 179.17 100 6 VAL A 53 ? ? 156.80 -18.63 101 6 VAL A 54 ? ? -156.66 29.93 102 6 LYS A 63 ? ? -73.41 -141.02 103 6 CYS A 64 ? ? -171.05 143.24 104 6 LYS A 65 ? ? 163.63 15.52 105 7 SER A 8 ? ? -41.32 162.29 106 7 CYS A 9 ? ? -119.32 -165.03 107 7 ASN A 11 ? ? -111.09 -132.20 108 7 GLU A 14 ? ? -94.14 -84.54 109 7 VAL A 15 ? ? 160.75 108.71 110 7 ASN A 20 ? ? 83.75 -35.95 111 7 ILE A 21 ? ? -89.83 -72.67 112 7 CYS A 31 ? ? -51.95 81.03 113 7 ALA A 36 ? ? -67.53 88.98 114 7 ALA A 44 ? ? 176.88 -175.55 115 7 PRO A 45 ? ? -35.52 161.33 116 7 ALA A 47 ? ? 86.68 -153.86 117 7 ASP A 49 ? ? 125.56 40.02 118 7 ALA A 51 ? ? -141.74 15.89 119 7 LEU A 52 ? ? 150.96 95.19 120 7 VAL A 53 ? ? -58.16 69.43 121 7 VAL A 54 ? ? 106.03 126.10 122 7 GLN A 56 ? ? -36.27 161.61 123 7 CYS A 61 ? ? -172.88 -176.00 124 7 GLU A 62 ? ? -166.16 -150.07 125 7 CYS A 64 ? ? 15.59 120.38 126 8 SER A 8 ? ? -43.14 161.01 127 8 ASN A 11 ? ? -120.66 -141.34 128 8 GLU A 12 ? ? -163.02 119.23 129 8 GLU A 14 ? ? -109.26 -77.50 130 8 VAL A 15 ? ? 152.89 106.85 131 8 ASN A 20 ? ? 80.17 -19.52 132 8 ILE A 21 ? ? -93.79 -78.53 133 8 CYS A 31 ? ? -48.81 80.29 134 8 GLU A 37 ? ? -65.48 87.45 135 8 LEU A 46 ? ? -107.22 -156.42 136 8 GLU A 48 ? ? 83.40 -14.68 137 8 ALA A 51 ? ? -143.26 25.05 138 8 LEU A 52 ? ? 102.00 120.04 139 8 VAL A 54 ? ? 175.01 97.47 140 8 CYS A 64 ? ? -134.14 -119.17 141 8 LYS A 65 ? ? 93.31 19.58 142 9 SER A 8 ? ? -55.35 179.83 143 9 VAL A 15 ? ? 77.07 127.05 144 9 HIS A 17 ? ? 39.00 47.62 145 9 ILE A 18 ? ? -34.63 140.39 146 9 PRO A 19 ? ? -50.64 -91.32 147 9 CYS A 31 ? ? -64.46 82.50 148 9 LEU A 46 ? ? -130.24 -155.74 149 9 ALA A 47 ? ? 5.55 113.00 150 9 CYS A 50 ? ? -52.80 -154.34 151 9 ALA A 51 ? ? 151.61 -9.63 152 9 LEU A 52 ? ? 166.41 -179.83 153 9 VAL A 53 ? ? 155.32 -12.13 154 9 VAL A 54 ? ? -151.89 28.31 155 9 LYS A 63 ? ? -60.73 -144.80 156 9 LYS A 65 ? ? 160.53 19.19 157 10 CYS A 9 ? ? -110.69 -168.67 158 10 ASN A 11 ? ? -123.16 -126.49 159 10 VAL A 15 ? ? 46.82 106.60 160 10 PRO A 19 ? ? -58.69 -90.60 161 10 ILE A 21 ? ? -95.79 -75.60 162 10 CYS A 31 ? ? -53.81 86.76 163 10 ALA A 36 ? ? -60.01 87.55 164 10 GLU A 37 ? ? -68.20 98.00 165 10 ALA A 47 ? ? -23.00 115.31 166 10 CYS A 50 ? ? -58.44 -151.48 167 10 ALA A 51 ? ? 155.94 -17.48 168 10 LEU A 52 ? ? 165.77 -179.58 169 10 VAL A 53 ? ? 153.95 -15.47 170 10 VAL A 54 ? ? -151.35 23.74 171 10 LYS A 63 ? ? -57.50 -129.77 172 10 CYS A 64 ? ? 170.72 143.82 173 10 LYS A 65 ? ? 166.68 20.68 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MBK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MBK _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;2 mM [U-99% 13C; U-99% 15N] CV2 VWC1, 20 mM sodium phosphate, 20 mM sodium chloride, 5 % [U-2H] D2O, 0.2 % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' '1.5 mM [U-99% 15N] CV2 VWC1, 20 mM sodium phosphate, 20 mM sodium chloride, 5 % [U-2H] D2O, 0.2 % sodium azide, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '2 mM CV2 VWC1, 20 mM sodium phosphate, 20 mM sodium chloride, 5 % [U-2H] D2O, 0.2 % sodium azide, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'CV2 VWC1-1' 2 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 20 ? mM ? 1 D2O-4 5 ? % '[U-2H]' 1 'sodium azide-5' 0.2 ? % ? 1 'CV2 VWC1-6' 1.5 ? mM '[U-99% 15N]' 2 'sodium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 20 ? mM ? 2 D2O-9 5 ? % '[U-2H]' 2 'sodium azide-10' 0.2 ? % ? 2 'CV2 VWC1-11' 2 ? mM ? 3 'sodium phosphate-12' 20 ? mM ? 3 'sodium chloride-13' 20 ? mM ? 3 D2O-14 5 ? % '[U-2H]' 3 'sodium azide-15' 0.2 ? % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.04 _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 3 '2D 1H-1H TOCSY' 1 2 3 '2D DQF-COSY' 1 3 3 '2D 1H-1H NOESY' 1 4 2 '3D 1H-15N NOESY' 1 5 2 '3D 1H-15N TOCSY' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HNCO' 1 9 1 '3D HN(CA)CO' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D H(CCO)NH' # _pdbx_nmr_refine.entry_id 2MBK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 'Bruker Biospin' processing TopSpin 2.1 2 'Neidig, Geyer, Gorler, Antz, Saffrich, Beneicke, Kalbitzer' 'data analysis' AURELIA 3.85 3 'Neidig, Geyer, Gorler, Antz, Saffrich, Beneicke, Kalbitzer' 'chemical shift assignment' AURELIA 3.85 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.29 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.29 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A SER -2 ? A SER 2 3 2 Y 1 A GLY -3 ? A GLY 1 4 2 Y 1 A SER -2 ? A SER 2 5 3 Y 1 A GLY -3 ? A GLY 1 6 3 Y 1 A SER -2 ? A SER 2 7 4 Y 1 A GLY -3 ? A GLY 1 8 4 Y 1 A SER -2 ? A SER 2 9 5 Y 1 A GLY -3 ? A GLY 1 10 5 Y 1 A SER -2 ? A SER 2 11 6 Y 1 A GLY -3 ? A GLY 1 12 6 Y 1 A SER -2 ? A SER 2 13 7 Y 1 A GLY -3 ? A GLY 1 14 7 Y 1 A SER -2 ? A SER 2 15 8 Y 1 A GLY -3 ? A GLY 1 16 8 Y 1 A SER -2 ? A SER 2 17 9 Y 1 A GLY -3 ? A GLY 1 18 9 Y 1 A SER -2 ? A SER 2 19 10 Y 1 A GLY -3 ? A GLY 1 20 10 Y 1 A SER -2 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 PRO N N N N 200 PRO CA C N S 201 PRO C C N N 202 PRO O O N N 203 PRO CB C N N 204 PRO CG C N N 205 PRO CD C N N 206 PRO OXT O N N 207 PRO H H N N 208 PRO HA H N N 209 PRO HB2 H N N 210 PRO HB3 H N N 211 PRO HG2 H N N 212 PRO HG3 H N N 213 PRO HD2 H N N 214 PRO HD3 H N N 215 PRO HXT H N N 216 SER N N N N 217 SER CA C N S 218 SER C C N N 219 SER O O N N 220 SER CB C N N 221 SER OG O N N 222 SER OXT O N N 223 SER H H N N 224 SER H2 H N N 225 SER HA H N N 226 SER HB2 H N N 227 SER HB3 H N N 228 SER HG H N N 229 SER HXT H N N 230 THR N N N N 231 THR CA C N S 232 THR C C N N 233 THR O O N N 234 THR CB C N R 235 THR OG1 O N N 236 THR CG2 C N N 237 THR OXT O N N 238 THR H H N N 239 THR H2 H N N 240 THR HA H N N 241 THR HB H N N 242 THR HG1 H N N 243 THR HG21 H N N 244 THR HG22 H N N 245 THR HG23 H N N 246 THR HXT H N N 247 TRP N N N N 248 TRP CA C N S 249 TRP C C N N 250 TRP O O N N 251 TRP CB C N N 252 TRP CG C Y N 253 TRP CD1 C Y N 254 TRP CD2 C Y N 255 TRP NE1 N Y N 256 TRP CE2 C Y N 257 TRP CE3 C Y N 258 TRP CZ2 C Y N 259 TRP CZ3 C Y N 260 TRP CH2 C Y N 261 TRP OXT O N N 262 TRP H H N N 263 TRP H2 H N N 264 TRP HA H N N 265 TRP HB2 H N N 266 TRP HB3 H N N 267 TRP HD1 H N N 268 TRP HE1 H N N 269 TRP HE3 H N N 270 TRP HZ2 H N N 271 TRP HZ3 H N N 272 TRP HH2 H N N 273 TRP HXT H N N 274 VAL N N N N 275 VAL CA C N S 276 VAL C C N N 277 VAL O O N N 278 VAL CB C N N 279 VAL CG1 C N N 280 VAL CG2 C N N 281 VAL OXT O N N 282 VAL H H N N 283 VAL H2 H N N 284 VAL HA H N N 285 VAL HB H N N 286 VAL HG11 H N N 287 VAL HG12 H N N 288 VAL HG13 H N N 289 VAL HG21 H N N 290 VAL HG22 H N N 291 VAL HG23 H N N 292 VAL HXT H N N 293 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 PRO N CA sing N N 190 PRO N CD sing N N 191 PRO N H sing N N 192 PRO CA C sing N N 193 PRO CA CB sing N N 194 PRO CA HA sing N N 195 PRO C O doub N N 196 PRO C OXT sing N N 197 PRO CB CG sing N N 198 PRO CB HB2 sing N N 199 PRO CB HB3 sing N N 200 PRO CG CD sing N N 201 PRO CG HG2 sing N N 202 PRO CG HG3 sing N N 203 PRO CD HD2 sing N N 204 PRO CD HD3 sing N N 205 PRO OXT HXT sing N N 206 SER N CA sing N N 207 SER N H sing N N 208 SER N H2 sing N N 209 SER CA C sing N N 210 SER CA CB sing N N 211 SER CA HA sing N N 212 SER C O doub N N 213 SER C OXT sing N N 214 SER CB OG sing N N 215 SER CB HB2 sing N N 216 SER CB HB3 sing N N 217 SER OG HG sing N N 218 SER OXT HXT sing N N 219 THR N CA sing N N 220 THR N H sing N N 221 THR N H2 sing N N 222 THR CA C sing N N 223 THR CA CB sing N N 224 THR CA HA sing N N 225 THR C O doub N N 226 THR C OXT sing N N 227 THR CB OG1 sing N N 228 THR CB CG2 sing N N 229 THR CB HB sing N N 230 THR OG1 HG1 sing N N 231 THR CG2 HG21 sing N N 232 THR CG2 HG22 sing N N 233 THR CG2 HG23 sing N N 234 THR OXT HXT sing N N 235 TRP N CA sing N N 236 TRP N H sing N N 237 TRP N H2 sing N N 238 TRP CA C sing N N 239 TRP CA CB sing N N 240 TRP CA HA sing N N 241 TRP C O doub N N 242 TRP C OXT sing N N 243 TRP CB CG sing N N 244 TRP CB HB2 sing N N 245 TRP CB HB3 sing N N 246 TRP CG CD1 doub Y N 247 TRP CG CD2 sing Y N 248 TRP CD1 NE1 sing Y N 249 TRP CD1 HD1 sing N N 250 TRP CD2 CE2 doub Y N 251 TRP CD2 CE3 sing Y N 252 TRP NE1 CE2 sing Y N 253 TRP NE1 HE1 sing N N 254 TRP CE2 CZ2 sing Y N 255 TRP CE3 CZ3 doub Y N 256 TRP CE3 HE3 sing N N 257 TRP CZ2 CH2 doub Y N 258 TRP CZ2 HZ2 sing N N 259 TRP CZ3 CH2 sing Y N 260 TRP CZ3 HZ3 sing N N 261 TRP CH2 HH2 sing N N 262 TRP OXT HXT sing N N 263 VAL N CA sing N N 264 VAL N H sing N N 265 VAL N H2 sing N N 266 VAL CA C sing N N 267 VAL CA CB sing N N 268 VAL CA HA sing N N 269 VAL C O doub N N 270 VAL C OXT sing N N 271 VAL CB CG1 sing N N 272 VAL CB CG2 sing N N 273 VAL CB HB sing N N 274 VAL CG1 HG11 sing N N 275 VAL CG1 HG12 sing N N 276 VAL CG1 HG13 sing N N 277 VAL CG2 HG21 sing N N 278 VAL CG2 HG22 sing N N 279 VAL CG2 HG23 sing N N 280 VAL OXT HXT sing N N 281 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 900 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2MBK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #