data_2MBV # _entry.id 2MBV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MBV pdb_00002mbv 10.2210/pdb2mbv/pdb RCSB RCSB103453 ? ? BMRB 19415 ? 10.13018/BMR19415 WWPDB D_1000103453 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-08-20 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_ref_seq_dif 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_spectrometer.model' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.value' 15 2 'Structure model' '_struct_conn.pdbx_dist_value' 16 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 2 'Structure model' '_struct_ref_seq_dif.details' 24 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MBV _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-08-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1RUT PDB 'LMO4 LIM1+LIM2 in complex with LDB1' unspecified 2L4Z PDB 'LMO4 LIM1 in complex with CtIP' unspecified 19415 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Joseph, S.' 1 'Matthews, J.M.' 2 'Kwan, A.H.-Y.' 3 'Mackay, J.P.' 4 'Cubeddu, L.' 5 'Foo, P.' 6 # _citation.id primary _citation.title 'Structural characterisation of LIM-only protein 4 (LMO4) in complex with Deformed Epidermal Autoregulatory Factor-1 (DEAF1)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Joseph, S.' 1 ? primary 'Kwan, A.H.' 2 ? primary 'Foo, P.' 3 ? primary 'Cubeddu, L.' 4 ? primary 'Mackay, J.P.' 5 ? primary 'Matthews, J.M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fusion protein of LIM domain transcription factor LMO4 (77-147) and DEAF1 (404-418)' 10142.460 1 ? ? 'LMO4 (UNP residues 77-147), DEAF1 (UNP residues 404-418)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGGSGGSG SIAPFPEAALPTSHPK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGGSGGSG SIAPFPEAALPTSHPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 TYR n 1 4 ILE n 1 5 ARG n 1 6 LEU n 1 7 PHE n 1 8 GLY n 1 9 ASN n 1 10 SER n 1 11 GLY n 1 12 ALA n 1 13 CYS n 1 14 SER n 1 15 ALA n 1 16 CYS n 1 17 GLY n 1 18 GLN n 1 19 SER n 1 20 ILE n 1 21 PRO n 1 22 ALA n 1 23 SER n 1 24 GLU n 1 25 LEU n 1 26 VAL n 1 27 MET n 1 28 ARG n 1 29 ALA n 1 30 GLN n 1 31 GLY n 1 32 ASN n 1 33 VAL n 1 34 TYR n 1 35 HIS n 1 36 LEU n 1 37 LYS n 1 38 CYS n 1 39 PHE n 1 40 THR n 1 41 CYS n 1 42 SER n 1 43 THR n 1 44 CYS n 1 45 ARG n 1 46 ASN n 1 47 ARG n 1 48 LEU n 1 49 VAL n 1 50 PRO n 1 51 GLY n 1 52 ASP n 1 53 ARG n 1 54 PHE n 1 55 HIS n 1 56 TYR n 1 57 ILE n 1 58 ASN n 1 59 GLY n 1 60 SER n 1 61 LEU n 1 62 PHE n 1 63 CYS n 1 64 GLU n 1 65 HIS n 1 66 ASP n 1 67 ARG n 1 68 PRO n 1 69 THR n 1 70 ALA n 1 71 LEU n 1 72 ILE n 1 73 ASN n 1 74 GLY n 1 75 GLY n 1 76 SER n 1 77 GLY n 1 78 GLY n 1 79 SER n 1 80 GLY n 1 81 SER n 1 82 ILE n 1 83 ALA n 1 84 PRO n 1 85 PHE n 1 86 PRO n 1 87 GLU n 1 88 ALA n 1 89 ALA n 1 90 LEU n 1 91 PRO n 1 92 THR n 1 93 SER n 1 94 HIS n 1 95 PRO n 1 96 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Lmo4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 TYR 3 77 77 TYR TYR A . n A 1 4 ILE 4 78 78 ILE ILE A . n A 1 5 ARG 5 79 79 ARG ARG A . n A 1 6 LEU 6 80 80 LEU LEU A . n A 1 7 PHE 7 81 81 PHE PHE A . n A 1 8 GLY 8 82 82 GLY GLY A . n A 1 9 ASN 9 83 83 ASN ASN A . n A 1 10 SER 10 84 84 SER SER A . n A 1 11 GLY 11 85 85 GLY GLY A . n A 1 12 ALA 12 86 86 ALA ALA A . n A 1 13 CYS 13 87 87 CYS CYS A . n A 1 14 SER 14 88 88 SER SER A . n A 1 15 ALA 15 89 89 ALA ALA A . n A 1 16 CYS 16 90 90 CYS CYS A . n A 1 17 GLY 17 91 91 GLY GLY A . n A 1 18 GLN 18 92 92 GLN GLN A . n A 1 19 SER 19 93 93 SER SER A . n A 1 20 ILE 20 94 94 ILE ILE A . n A 1 21 PRO 21 95 95 PRO PRO A . n A 1 22 ALA 22 96 96 ALA ALA A . n A 1 23 SER 23 97 97 SER SER A . n A 1 24 GLU 24 98 98 GLU GLU A . n A 1 25 LEU 25 99 99 LEU LEU A . n A 1 26 VAL 26 100 100 VAL VAL A . n A 1 27 MET 27 101 101 MET MET A . n A 1 28 ARG 28 102 102 ARG ARG A . n A 1 29 ALA 29 103 103 ALA ALA A . n A 1 30 GLN 30 104 104 GLN GLN A . n A 1 31 GLY 31 105 105 GLY GLY A . n A 1 32 ASN 32 106 106 ASN ASN A . n A 1 33 VAL 33 107 107 VAL VAL A . n A 1 34 TYR 34 108 108 TYR TYR A . n A 1 35 HIS 35 109 109 HIS HIS A . n A 1 36 LEU 36 110 110 LEU LEU A . n A 1 37 LYS 37 111 111 LYS LYS A . n A 1 38 CYS 38 112 112 CYS CYS A . n A 1 39 PHE 39 113 113 PHE PHE A . n A 1 40 THR 40 114 114 THR THR A . n A 1 41 CYS 41 115 115 CYS CYS A . n A 1 42 SER 42 116 116 SER SER A . n A 1 43 THR 43 117 117 THR THR A . n A 1 44 CYS 44 118 118 CYS CYS A . n A 1 45 ARG 45 119 119 ARG ARG A . n A 1 46 ASN 46 120 120 ASN ASN A . n A 1 47 ARG 47 121 121 ARG ARG A . n A 1 48 LEU 48 122 122 LEU LEU A . n A 1 49 VAL 49 123 123 VAL VAL A . n A 1 50 PRO 50 124 124 PRO PRO A . n A 1 51 GLY 51 125 125 GLY GLY A . n A 1 52 ASP 52 126 126 ASP ASP A . n A 1 53 ARG 53 127 127 ARG ARG A . n A 1 54 PHE 54 128 128 PHE PHE A . n A 1 55 HIS 55 129 129 HIS HIS A . n A 1 56 TYR 56 130 130 TYR TYR A . n A 1 57 ILE 57 131 131 ILE ILE A . n A 1 58 ASN 58 132 132 ASN ASN A . n A 1 59 GLY 59 133 133 GLY GLY A . n A 1 60 SER 60 134 134 SER SER A . n A 1 61 LEU 61 135 135 LEU LEU A . n A 1 62 PHE 62 136 136 PHE PHE A . n A 1 63 CYS 63 137 137 CYS CYS A . n A 1 64 GLU 64 138 138 GLU GLU A . n A 1 65 HIS 65 139 139 HIS HIS A . n A 1 66 ASP 66 140 140 ASP ASP A . n A 1 67 ARG 67 141 141 ARG ARG A . n A 1 68 PRO 68 142 142 PRO PRO A . n A 1 69 THR 69 143 143 THR THR A . n A 1 70 ALA 70 144 144 ALA ALA A . n A 1 71 LEU 71 145 145 LEU LEU A . n A 1 72 ILE 72 146 146 ILE ILE A . n A 1 73 ASN 73 147 147 ASN ASN A . n A 1 74 GLY 74 201 901 GLY GLY A . n A 1 75 GLY 75 202 902 GLY GLY A . n A 1 76 SER 76 203 903 SER SER A . n A 1 77 GLY 77 204 904 GLY GLY A . n A 1 78 GLY 78 205 905 GLY GLY A . n A 1 79 SER 79 206 906 SER SER A . n A 1 80 GLY 80 207 907 GLY GLY A . n A 1 81 SER 81 208 908 SER SER A . n A 1 82 ILE 82 404 404 ILE ILE A . n A 1 83 ALA 83 405 405 ALA ALA A . n A 1 84 PRO 84 406 406 PRO PRO A . n A 1 85 PHE 85 407 407 PHE PHE A . n A 1 86 PRO 86 408 408 PRO PRO A . n A 1 87 GLU 87 409 409 GLU GLU A . n A 1 88 ALA 88 410 410 ALA ALA A . n A 1 89 ALA 89 411 411 ALA ALA A . n A 1 90 LEU 90 412 412 LEU LEU A . n A 1 91 PRO 91 413 413 PRO PRO A . n A 1 92 THR 92 414 414 THR THR A . n A 1 93 SER 93 415 415 SER SER A . n A 1 94 HIS 94 416 416 HIS HIS A . n A 1 95 PRO 95 417 417 PRO PRO A . n A 1 96 LYS 96 418 418 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1001 603 ZN ZN A . C 2 ZN 1 1002 604 ZN ZN A . # _cell.entry_id 2MBV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MBV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MBV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MBV _struct.title 'LMO4-LIM2 in complex with DEAF1 (404-418)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MBV _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'LMO4, DEAF1, transcription, embryonic development, cancer' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP LMO4_MOUSE P61969 1 YIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALIN 77 ? 2 UNP DEAF1_MOUSE Q9Z1T5 1 IAPFPEAALPTSHPK 404 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2MBV A 3 ? 73 ? P61969 77 ? 147 ? 77 147 2 2 2MBV A 82 ? 96 ? Q9Z1T5 404 ? 418 ? 404 418 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MBV GLY A 1 ? UNP P61969 ? ? 'expression tag' 1 1 1 2MBV SER A 2 ? UNP P61969 ? ? 'expression tag' 2 2 1 2MBV GLY A 74 ? UNP P61969 ? ? linker 201 3 1 2MBV GLY A 75 ? UNP P61969 ? ? linker 202 4 1 2MBV SER A 76 ? UNP P61969 ? ? linker 203 5 1 2MBV GLY A 77 ? UNP P61969 ? ? linker 204 6 1 2MBV GLY A 78 ? UNP P61969 ? ? linker 205 7 1 2MBV SER A 79 ? UNP P61969 ? ? linker 206 8 1 2MBV GLY A 80 ? UNP P61969 ? ? linker 207 9 1 2MBV SER A 81 ? UNP P61969 ? ? linker 208 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 87 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 90 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc3 metalc ? ? A HIS 35 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 109 A ZN 1001 1_555 ? ? ? ? ? ? ? 1.994 ? ? metalc4 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 112 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc5 metalc ? ? A CYS 41 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 115 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc6 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 118 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc7 metalc ? ? A CYS 63 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 137 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc8 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 140 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.005 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 87 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 16 ? A CYS 90 ? 1_555 110.4 ? 2 SG ? A CYS 13 ? A CYS 87 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 ND1 ? A HIS 35 ? A HIS 109 ? 1_555 108.2 ? 3 SG ? A CYS 16 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 ND1 ? A HIS 35 ? A HIS 109 ? 1_555 106.5 ? 4 SG ? A CYS 13 ? A CYS 87 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 38 ? A CYS 112 ? 1_555 112.8 ? 5 SG ? A CYS 16 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 38 ? A CYS 112 ? 1_555 111.1 ? 6 ND1 ? A HIS 35 ? A HIS 109 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 38 ? A CYS 112 ? 1_555 107.6 ? 7 SG ? A CYS 41 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 44 ? A CYS 118 ? 1_555 113.3 ? 8 SG ? A CYS 41 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 63 ? A CYS 137 ? 1_555 114.8 ? 9 SG ? A CYS 44 ? A CYS 118 ? 1_555 ZN ? C ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 63 ? A CYS 137 ? 1_555 115.5 ? 10 SG ? A CYS 41 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 1002 ? 1_555 OD2 ? A ASP 66 ? A ASP 140 ? 1_555 103.7 ? 11 SG ? A CYS 44 ? A CYS 118 ? 1_555 ZN ? C ZN . ? A ZN 1002 ? 1_555 OD2 ? A ASP 66 ? A ASP 140 ? 1_555 103.8 ? 12 SG ? A CYS 63 ? A CYS 137 ? 1_555 ZN ? C ZN . ? A ZN 1002 ? 1_555 OD2 ? A ASP 66 ? A ASP 140 ? 1_555 103.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 33 ? HIS A 35 ? VAL A 107 HIS A 109 A 2 VAL A 26 ? ARG A 28 ? VAL A 100 ARG A 102 A 3 PRO A 86 ? GLU A 87 ? PRO A 408 GLU A 409 B 1 PHE A 54 ? ILE A 57 ? PHE A 128 ILE A 131 B 2 SER A 60 ? CYS A 63 ? SER A 134 CYS A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 34 ? O TYR A 108 N MET A 27 ? N MET A 101 A 2 3 N VAL A 26 ? N VAL A 100 O GLU A 87 ? O GLU A 409 B 1 2 N HIS A 55 ? N HIS A 129 O PHE A 62 ? O PHE A 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 1001 ? 4 'BINDING SITE FOR RESIDUE ZN A 1001' AC2 Software A ZN 1002 ? 4 'BINDING SITE FOR RESIDUE ZN A 1002' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 13 ? CYS A 87 . ? 1_555 ? 2 AC1 4 CYS A 16 ? CYS A 90 . ? 1_555 ? 3 AC1 4 HIS A 35 ? HIS A 109 . ? 1_555 ? 4 AC1 4 CYS A 38 ? CYS A 112 . ? 1_555 ? 5 AC2 4 CYS A 41 ? CYS A 115 . ? 1_555 ? 6 AC2 4 CYS A 44 ? CYS A 118 . ? 1_555 ? 7 AC2 4 CYS A 63 ? CYS A 137 . ? 1_555 ? 8 AC2 4 ASP A 66 ? ASP A 140 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD12 A LEU 80 ? ? HA A ASN 83 ? ? 1.33 2 3 HB3 A CYS 87 ? ? H A GLY 91 ? ? 1.30 3 4 HE A ARG 79 ? ? HA3 A GLY 91 ? ? 1.35 4 4 OE2 A GLU 98 ? ? HZ1 A LYS 111 ? ? 1.58 5 5 HB2 A GLN 104 ? ? H A GLY 105 ? ? 1.32 6 9 OE2 A GLU 98 ? ? HZ3 A LYS 111 ? ? 1.58 7 15 H A HIS 109 ? ? HB2 A CYS 112 ? ? 1.21 8 15 HB3 A CYS 87 ? ? H A GLY 91 ? ? 1.33 9 16 OE2 A GLU 98 ? ? HZ3 A LYS 111 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 80 ? ? -94.50 46.73 2 1 SER A 93 ? ? 62.43 128.67 3 1 ALA A 103 ? ? -113.67 -122.59 4 1 ARG A 141 ? ? 55.27 72.29 5 1 PRO A 142 ? ? -55.00 99.51 6 1 SER A 203 ? ? -95.50 -101.98 7 1 ALA A 411 ? ? -105.75 -84.29 8 2 TYR A 77 ? ? -143.22 26.75 9 2 ASN A 83 ? ? -147.01 22.56 10 2 ALA A 103 ? ? -119.78 -165.11 11 2 HIS A 109 ? ? -103.91 -157.67 12 2 PHE A 113 ? ? -69.87 85.35 13 2 ASP A 126 ? ? -105.42 -145.12 14 2 PRO A 142 ? ? -62.55 92.67 15 2 ASN A 147 ? ? -68.66 93.05 16 2 ILE A 404 ? ? -84.42 -76.03 17 2 ALA A 405 ? ? 179.34 151.67 18 2 PHE A 407 ? ? 74.15 145.80 19 2 ALA A 411 ? ? -85.97 -102.99 20 3 ARG A 79 ? ? -176.25 -26.57 21 3 ASN A 83 ? ? -152.29 35.33 22 3 SER A 84 ? ? -106.62 -113.69 23 3 ALA A 103 ? ? -122.40 -162.28 24 3 HIS A 109 ? ? -110.58 -157.42 25 3 PRO A 124 ? ? -55.82 109.95 26 3 ARG A 141 ? ? -22.64 99.22 27 3 ALA A 144 ? ? 65.66 -84.21 28 3 ASN A 147 ? ? -173.13 113.12 29 3 ALA A 411 ? ? -136.32 -145.23 30 3 SER A 415 ? ? 59.98 -102.69 31 4 ARG A 79 ? ? -131.58 -42.55 32 4 ASN A 83 ? ? 170.24 167.48 33 4 SER A 84 ? ? 71.03 -60.94 34 4 ALA A 103 ? ? -104.71 -83.34 35 4 ASP A 126 ? ? -101.93 -152.82 36 4 THR A 143 ? ? 75.26 121.83 37 4 ALA A 144 ? ? -75.50 39.95 38 4 LEU A 145 ? ? -162.69 27.06 39 4 ASN A 147 ? ? 72.47 159.98 40 4 PRO A 406 ? ? -74.68 -164.35 41 4 ALA A 411 ? ? -93.85 -135.52 42 5 ASN A 83 ? ? 61.01 94.49 43 5 SER A 84 ? ? -146.82 -146.15 44 5 CYS A 90 ? ? -110.18 -74.65 45 5 GLN A 104 ? ? -152.63 -127.45 46 5 PHE A 113 ? ? -67.50 82.75 47 5 ARG A 119 ? ? 81.02 50.97 48 5 ALA A 144 ? ? -97.55 -74.14 49 5 ASN A 147 ? ? -87.55 45.77 50 5 SER A 203 ? ? -87.43 31.37 51 5 PRO A 406 ? ? -45.64 -72.78 52 5 PHE A 407 ? ? 168.95 139.28 53 5 SER A 415 ? ? 64.92 -149.06 54 6 PHE A 81 ? ? 49.28 84.48 55 6 ASN A 83 ? ? 71.11 54.39 56 6 ALA A 103 ? ? -118.48 -76.54 57 6 GLN A 104 ? ? -90.64 -93.64 58 6 CYS A 137 ? ? -113.55 -167.23 59 6 ASP A 140 ? ? -66.47 -80.89 60 6 PRO A 142 ? ? -66.01 92.37 61 6 ALA A 144 ? ? -125.68 -65.88 62 6 ALA A 411 ? ? -103.38 -106.30 63 7 ASN A 83 ? ? 81.75 33.76 64 7 ALA A 89 ? ? -120.94 -59.62 65 7 CYS A 90 ? ? -93.09 -77.61 66 7 GLN A 104 ? ? -179.41 -128.81 67 7 CYS A 137 ? ? -113.78 -169.65 68 7 ASP A 140 ? ? -67.18 -82.15 69 7 ARG A 141 ? ? 42.46 73.33 70 7 PRO A 142 ? ? -55.41 100.91 71 7 ALA A 144 ? ? -158.72 -78.10 72 7 SER A 203 ? ? -121.46 -52.61 73 7 ALA A 411 ? ? -84.80 -102.94 74 8 PHE A 81 ? ? -92.15 -60.56 75 8 ASN A 83 ? ? 60.92 93.42 76 8 SER A 84 ? ? -146.31 -76.78 77 8 CYS A 90 ? ? -100.03 -79.20 78 8 GLN A 104 ? ? -154.76 -137.84 79 8 ARG A 119 ? ? 70.61 38.98 80 8 ARG A 141 ? ? 43.64 88.23 81 8 ALA A 144 ? ? -147.87 -56.75 82 8 PRO A 406 ? ? -57.54 -90.99 83 8 ALA A 411 ? ? -84.11 -94.09 84 8 SER A 415 ? ? 63.77 -151.58 85 9 CYS A 137 ? ? -109.27 -168.45 86 9 ARG A 141 ? ? -29.69 105.61 87 9 SER A 206 ? ? -129.45 -152.23 88 9 PRO A 406 ? ? -67.01 -176.19 89 9 ALA A 411 ? ? -90.88 -141.35 90 10 ARG A 79 ? ? -164.71 -32.66 91 10 PHE A 81 ? ? 52.64 74.69 92 10 ASN A 83 ? ? -162.02 66.78 93 10 SER A 84 ? ? -114.38 -72.47 94 10 GLN A 104 ? ? 70.20 -2.64 95 10 HIS A 109 ? ? -92.73 -159.14 96 10 ASP A 140 ? ? -104.07 -67.86 97 10 ARG A 141 ? ? 52.51 89.66 98 10 PRO A 142 ? ? -58.19 99.42 99 10 ILE A 146 ? ? -99.66 46.36 100 10 PHE A 407 ? ? 78.06 156.59 101 10 ALA A 411 ? ? -91.92 -143.03 102 11 ASN A 83 ? ? 69.41 161.73 103 11 SER A 84 ? ? 71.76 -61.15 104 11 GLN A 104 ? ? -167.30 91.12 105 11 ASP A 140 ? ? -66.35 -77.73 106 11 ARG A 141 ? ? 44.18 70.59 107 11 SER A 203 ? ? 39.68 63.24 108 11 PRO A 406 ? ? -69.45 10.29 109 11 PHE A 407 ? ? 70.34 158.54 110 11 ALA A 411 ? ? -94.45 -139.48 111 11 SER A 415 ? ? 71.73 152.99 112 12 ARG A 79 ? ? -151.21 33.03 113 12 SER A 84 ? ? 62.09 73.29 114 12 CYS A 90 ? ? -91.09 -73.97 115 12 GLN A 104 ? ? -174.34 -106.08 116 12 PHE A 113 ? ? -64.85 98.27 117 12 PRO A 124 ? ? -57.09 109.56 118 12 PRO A 406 ? ? -46.31 -82.67 119 12 PHE A 407 ? ? 169.80 150.64 120 12 ALA A 411 ? ? -84.20 -90.78 121 12 SER A 415 ? ? 56.03 -124.35 122 13 ASN A 83 ? ? -65.01 87.51 123 13 SER A 84 ? ? -148.76 -58.68 124 13 CYS A 90 ? ? -95.32 -72.85 125 13 GLN A 104 ? ? -148.98 -128.72 126 13 ASP A 126 ? ? -112.78 -168.91 127 13 ARG A 141 ? ? 43.16 71.39 128 13 ALA A 144 ? ? -104.20 -63.51 129 13 ALA A 411 ? ? -80.50 -91.90 130 13 SER A 415 ? ? 73.59 82.87 131 14 SER A 2 ? ? -68.38 99.02 132 14 LEU A 80 ? ? -145.75 14.41 133 14 PHE A 81 ? ? 49.65 -108.61 134 14 SER A 84 ? ? -163.11 -73.73 135 14 CYS A 90 ? ? -103.21 -64.65 136 14 GLN A 104 ? ? -176.28 114.25 137 14 CYS A 137 ? ? -114.08 -168.97 138 14 LEU A 145 ? ? -143.21 -102.37 139 14 ILE A 146 ? ? 62.73 101.56 140 14 ASN A 147 ? ? -68.36 98.73 141 14 ALA A 411 ? ? -85.77 -89.35 142 15 PHE A 81 ? ? -73.22 -78.96 143 15 ASN A 83 ? ? -56.41 100.69 144 15 SER A 84 ? ? -153.99 -62.15 145 15 ALA A 103 ? ? -130.58 -134.78 146 15 ASP A 126 ? ? -117.33 -161.18 147 15 CYS A 137 ? ? -119.09 -165.93 148 15 ALA A 144 ? ? -99.05 -98.88 149 15 PHE A 407 ? ? 73.89 156.95 150 16 ARG A 79 ? ? -145.47 22.38 151 16 CYS A 90 ? ? -102.95 -77.35 152 16 ALA A 103 ? ? -112.22 -147.93 153 16 PHE A 113 ? ? -67.60 83.57 154 16 ASN A 147 ? ? -100.39 78.00 155 16 PRO A 406 ? ? -44.05 -71.06 156 16 PHE A 407 ? ? 149.92 157.93 157 16 ALA A 411 ? ? -107.38 -120.30 158 16 SER A 415 ? ? 62.59 179.08 159 17 GLN A 104 ? ? -161.53 -129.18 160 17 HIS A 109 ? ? -99.42 -149.58 161 17 ASP A 126 ? ? -113.72 -159.44 162 17 ARG A 141 ? ? -20.79 101.88 163 17 ALA A 144 ? ? 73.94 -62.04 164 17 ILE A 146 ? ? -117.54 78.37 165 17 ILE A 404 ? ? -125.05 -94.03 166 17 PHE A 407 ? ? 76.17 149.93 167 17 ALA A 411 ? ? -107.21 -166.38 168 18 ASN A 83 ? ? 69.24 65.49 169 18 ALA A 89 ? ? -124.95 -55.78 170 18 ALA A 103 ? ? -124.38 -113.40 171 18 HIS A 109 ? ? -112.29 -155.06 172 18 ARG A 141 ? ? 24.24 84.86 173 18 SER A 203 ? ? -79.74 -80.02 174 18 SER A 206 ? ? 54.54 -107.34 175 18 PRO A 406 ? ? -69.85 8.13 176 18 PHE A 407 ? ? 71.07 159.71 177 18 ALA A 411 ? ? -103.40 -134.15 178 19 SER A 2 ? ? -92.76 -61.86 179 19 TYR A 77 ? ? -100.57 49.93 180 19 ARG A 79 ? ? -145.97 13.77 181 19 ASN A 83 ? ? 67.22 83.82 182 19 SER A 84 ? ? -139.68 -43.06 183 19 GLN A 104 ? ? -171.73 -100.93 184 19 HIS A 109 ? ? -114.17 -161.59 185 19 LEU A 145 ? ? -146.00 55.93 186 19 ILE A 146 ? ? -164.95 -35.85 187 19 ALA A 411 ? ? -89.83 -83.78 188 19 THR A 414 ? ? -93.47 -126.67 189 20 TYR A 77 ? ? 66.92 79.13 190 20 ARG A 79 ? ? -147.90 -1.34 191 20 ASP A 126 ? ? -116.61 -153.36 192 20 CYS A 137 ? ? -130.78 -153.18 193 20 ASP A 140 ? ? -96.07 31.17 194 20 ALA A 144 ? ? -150.43 -77.04 195 20 ASN A 147 ? ? 67.68 -78.38 196 20 SER A 415 ? ? 71.44 -174.80 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MBV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MBV _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.3-0.7 mM [U-99% 13C; U-99% 15N] DIC4, 20 mM acetic acid, 35 mM sodium chloride, 1 mM DTT, 0.067 mM DSS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DIC4-1 ? 0.3-0.7 mM '[U-99% 13C; U-99% 15N]' 1 'acetic acid-2' 20 ? mM ? 1 'sodium chloride-3' 35 ? mM ? 1 DTT-4 1 ? mM ? 1 DSS-5 0.067 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.13 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D DQF-COSY' 1 4 1 '2D 1H-1H TOCSY' 1 5 1 '2D 1H-1H NOESY' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HNCO' 1 11 1 '3D HNCACO' 1 12 1 '3D 1H-15N NOESY' 1 13 1 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MBV _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 894 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 450 _pdbx_nmr_constraints.NOE_long_range_total_count 227 _pdbx_nmr_constraints.NOE_medium_range_total_count 45 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 172 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 43 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 43 # _pdbx_nmr_refine.entry_id 2MBV _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, matrix relaxation, torsion angle dynamics, distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA 0.2 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2MBV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S ZN # loop_