data_2MBY # _entry.id 2MBY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MBY pdb_00002mby 10.2210/pdb2mby/pdb RCSB RCSB103455 ? ? BMRB 19416 ? ? WWPDB D_1000103455 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4M5D PDB 'Crystal Structure of Rrp7 N-terminal Domain' unspecified 19416 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MBY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-08-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lin, J.' 1 'Feng, Y.' 2 'Ye, K.' 3 # _citation.id primary _citation.title 'An RNA-Binding Complex Involved in Ribosome Biogenesis Contains a Protein with Homology to tRNA CCA-Adding Enzyme.' _citation.journal_abbrev 'Plos Biol.' _citation.journal_volume 11 _citation.page_first e1001669 _citation.page_last e1001669 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1544-9173 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24130456 _citation.pdbx_database_id_DOI 10.1371/journal.pbio.1001669 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lin, J.' 1 ? primary 'Lu, J.' 2 ? primary 'Feng, Y.' 3 ? primary 'Sun, M.' 4 ? primary 'Ye, K.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribosomal RNA-processing protein 7' _entity.formula_weight 5732.637 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 256-297' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPEADFYRFQVRERKKQEINQLLSKFKEDQERIKVMKAKRKFNPYT _entity_poly.pdbx_seq_one_letter_code_can GPEADFYRFQVRERKKQEINQLLSKFKEDQERIKVMKAKRKFNPYT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLU n 1 4 ALA n 1 5 ASP n 1 6 PHE n 1 7 TYR n 1 8 ARG n 1 9 PHE n 1 10 GLN n 1 11 VAL n 1 12 ARG n 1 13 GLU n 1 14 ARG n 1 15 LYS n 1 16 LYS n 1 17 GLN n 1 18 GLU n 1 19 ILE n 1 20 ASN n 1 21 GLN n 1 22 LEU n 1 23 LEU n 1 24 SER n 1 25 LYS n 1 26 PHE n 1 27 LYS n 1 28 GLU n 1 29 ASP n 1 30 GLN n 1 31 GLU n 1 32 ARG n 1 33 ILE n 1 34 LYS n 1 35 VAL n 1 36 MET n 1 37 LYS n 1 38 ALA n 1 39 LYS n 1 40 ARG n 1 41 LYS n 1 42 PHE n 1 43 ASN n 1 44 PRO n 1 45 TYR n 1 46 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RRP7, YCL031C, YCL184, YCL31C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PETDuet _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RRP7_YEAST _struct_ref.pdbx_db_accession P25368 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DFYRFQVRERKKQEINQLLSKFKEDQERIKVMKAKRKFNPYT _struct_ref.pdbx_align_begin 256 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MBY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25368 _struct_ref_seq.db_align_beg 256 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 297 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 256 _struct_ref_seq.pdbx_auth_seq_align_end 297 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MBY GLY A 1 ? UNP P25368 ? ? 'expression tag' 252 1 1 2MBY PRO A 2 ? UNP P25368 ? ? 'expression tag' 253 2 1 2MBY GLU A 3 ? UNP P25368 ? ? 'expression tag' 254 3 1 2MBY ALA A 4 ? UNP P25368 ? ? 'expression tag' 255 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N TOCSY' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HNCACB' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] protein, 50 mM potassium phosphate, 0.05 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _pdbx_nmr_refine.entry_id 2MBY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MBY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MBY _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 3 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 4 'Accelrys Software Inc.' processing Felix ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MBY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MBY _struct.title 'NMR Structure of Rrp7 C-terminal Domain' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MBY _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text '90s preribosome, nucleolus, rna binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 1 ? LYS A 15 ? GLY A 252 LYS A 266 1 ? 15 HELX_P HELX_P2 2 GLN A 17 ? ALA A 38 ? GLN A 268 ALA A 289 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MBY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 252 252 GLY GLY A . n A 1 2 PRO 2 253 253 PRO PRO A . n A 1 3 GLU 3 254 254 GLU GLU A . n A 1 4 ALA 4 255 255 ALA ALA A . n A 1 5 ASP 5 256 256 ASP ASP A . n A 1 6 PHE 6 257 257 PHE PHE A . n A 1 7 TYR 7 258 258 TYR TYR A . n A 1 8 ARG 8 259 259 ARG ARG A . n A 1 9 PHE 9 260 260 PHE PHE A . n A 1 10 GLN 10 261 261 GLN GLN A . n A 1 11 VAL 11 262 262 VAL VAL A . n A 1 12 ARG 12 263 263 ARG ARG A . n A 1 13 GLU 13 264 264 GLU GLU A . n A 1 14 ARG 14 265 265 ARG ARG A . n A 1 15 LYS 15 266 266 LYS LYS A . n A 1 16 LYS 16 267 267 LYS LYS A . n A 1 17 GLN 17 268 268 GLN GLN A . n A 1 18 GLU 18 269 269 GLU GLU A . n A 1 19 ILE 19 270 270 ILE ILE A . n A 1 20 ASN 20 271 271 ASN ASN A . n A 1 21 GLN 21 272 272 GLN GLN A . n A 1 22 LEU 22 273 273 LEU LEU A . n A 1 23 LEU 23 274 274 LEU LEU A . n A 1 24 SER 24 275 275 SER SER A . n A 1 25 LYS 25 276 276 LYS LYS A . n A 1 26 PHE 26 277 277 PHE PHE A . n A 1 27 LYS 27 278 278 LYS LYS A . n A 1 28 GLU 28 279 279 GLU GLU A . n A 1 29 ASP 29 280 280 ASP ASP A . n A 1 30 GLN 30 281 281 GLN GLN A . n A 1 31 GLU 31 282 282 GLU GLU A . n A 1 32 ARG 32 283 283 ARG ARG A . n A 1 33 ILE 33 284 284 ILE ILE A . n A 1 34 LYS 34 285 285 LYS LYS A . n A 1 35 VAL 35 286 286 VAL VAL A . n A 1 36 MET 36 287 287 MET MET A . n A 1 37 LYS 37 288 288 LYS LYS A . n A 1 38 ALA 38 289 289 ALA ALA A . n A 1 39 LYS 39 290 290 LYS LYS A . n A 1 40 ARG 40 291 291 ARG ARG A . n A 1 41 LYS 41 292 292 LYS LYS A . n A 1 42 PHE 42 293 293 PHE PHE A . n A 1 43 ASN 43 294 294 ASN ASN A . n A 1 44 PRO 44 295 295 PRO PRO A . n A 1 45 TYR 45 296 296 TYR TYR A . n A 1 46 THR 46 297 297 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-09-25 2 'Structure model' 1 1 2013-11-06 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'potassium phosphate-2' 50 ? mM ? 1 'sodium azide-3' 0.05 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 265 ? ? -57.38 -80.62 2 1 LYS A 266 ? ? 177.26 -177.35 3 1 ALA A 289 ? ? 61.15 -79.37 4 1 LYS A 292 ? ? -92.01 51.39 #