data_2MCS # _entry.id 2MCS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MCS RCSB RCSB103482 BMRB 19452 WWPDB D_1000103482 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2017-09-20 _pdbx_database_PDB_obs_spr.pdb_id 6AMR _pdbx_database_PDB_obs_spr.replace_pdb_id 2MCS _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19452 BMRB unspecified . SSGCID-EhchA.00546.a TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MCS _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-08-26 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_mr OBS _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs OBS _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 # _citation.id primary _citation.title 'Solution structure of the Ehrlichia chaffeensis thioredoxin ECH_0218 in the reduced state: disorder around the CXXC active site.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Buchko, G.W.' 1 primary 'Hewitt, S.N.' 2 primary 'Van Voorhis, W.C.' 3 primary 'Myler, P.J.' 4 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 14362.208 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKIN IEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNNIN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKIN IEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNNIN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SSGCID-EhchA.00546.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 MET n 1 23 ILE n 1 24 GLU n 1 25 GLN n 1 26 ILE n 1 27 GLY n 1 28 ASP n 1 29 SER n 1 30 GLU n 1 31 PHE n 1 32 ASP n 1 33 ASN n 1 34 LYS n 1 35 VAL n 1 36 THR n 1 37 SER n 1 38 CYS n 1 39 ASN n 1 40 ASP n 1 41 ASN n 1 42 ILE n 1 43 LEU n 1 44 ILE n 1 45 LEU n 1 46 VAL n 1 47 ASP n 1 48 PHE n 1 49 TRP n 1 50 ALA n 1 51 PRO n 1 52 TRP n 1 53 CYS n 1 54 GLY n 1 55 PRO n 1 56 CYS n 1 57 ARG n 1 58 SER n 1 59 LEU n 1 60 GLU n 1 61 PRO n 1 62 GLN n 1 63 LEU n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 ALA n 1 68 GLN n 1 69 GLN n 1 70 TYR n 1 71 THR n 1 72 GLU n 1 73 ASN n 1 74 VAL n 1 75 LYS n 1 76 ILE n 1 77 TYR n 1 78 LYS n 1 79 ILE n 1 80 ASN n 1 81 ILE n 1 82 GLU n 1 83 ASP n 1 84 ASN n 1 85 GLN n 1 86 ASP n 1 87 VAL n 1 88 ALA n 1 89 THR n 1 90 GLN n 1 91 TYR n 1 92 GLY n 1 93 VAL n 1 94 SER n 1 95 ALA n 1 96 ILE n 1 97 PRO n 1 98 THR n 1 99 ILE n 1 100 LEU n 1 101 MET n 1 102 PHE n 1 103 LYS n 1 104 ASN n 1 105 GLY n 1 106 LYS n 1 107 LYS n 1 108 LEU n 1 109 SER n 1 110 GLN n 1 111 VAL n 1 112 ILE n 1 113 GLY n 1 114 ALA n 1 115 ASP n 1 116 ILE n 1 117 SER n 1 118 LYS n 1 119 ILE n 1 120 ILE n 1 121 SER n 1 122 GLU n 1 123 ILE n 1 124 ASN n 1 125 ASN n 1 126 ASN n 1 127 ILE n 1 128 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ECH_0218, trx' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Arkansas _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ehrlichia chaffeensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 205920 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-R3-pRARE2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name AVA0421 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2GHP2_EHRCR _struct_ref.pdbx_db_accession Q2GHP2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILM FKNGKKLSQVIGADISKIISEINNNIN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MCS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2GHP2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MCS MET A 1 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 1 1 1 2MCS ALA A 2 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 2 2 1 2MCS HIS A 3 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 3 3 1 2MCS HIS A 4 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 4 4 1 2MCS HIS A 5 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 5 5 1 2MCS HIS A 6 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 6 6 1 2MCS HIS A 7 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 7 7 1 2MCS HIS A 8 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 8 8 1 2MCS MET A 9 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 9 9 1 2MCS GLY A 10 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 10 10 1 2MCS THR A 11 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 11 11 1 2MCS LEU A 12 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 12 12 1 2MCS GLU A 13 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 13 13 1 2MCS ALA A 14 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 14 14 1 2MCS GLN A 15 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 15 15 1 2MCS THR A 16 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 16 16 1 2MCS GLN A 17 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 17 17 1 2MCS GLY A 18 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 18 18 1 2MCS PRO A 19 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 19 19 1 2MCS GLY A 20 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 20 20 1 2MCS SER A 21 ? UNP Q2GHP2 ? ? 'EXPRESSION TAG' 21 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D C(CO)NH' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HNCO' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' 1 11 2 'deuterium exchange' 1 12 1 '3D H(CCO)NH' 1 13 1 '2D HBCBCGCDCDHD' 1 14 1 '2D HBCBCGCDCEHE' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 1 mM [U-99% 13C; U-99% 15N] protein, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 1 mM [U-99% 15N] protein, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MCS _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN. THE FINAL ENSEMBLE OF STRUCTURES WERE NOT REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS). ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MCS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MCS _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 Goddard 'data analysis' SPARKY 3.115 2 Goddard 'peak picking' SPARKY 3.115 3 'Accelrys Software Inc.' processing Felix 2007 4 'Bhattacharya and Montelione' 'data analysis' PSVS 1.3 5 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 6 ? refinement CYANA ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MCS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MCS _struct.title ;Solution NMR structure of a putative thioredoxin (ECH_0218) in the reduced state from Ehrlichia chaffeensis, the etiological agent responsible for human monocytic ehrlichiosis. Seattle Structural Genomics Center for Infectious Disease target EhchA.00546.a ; _struct.pdbx_descriptor Thioredoxin _struct.pdbx_model_details 'closest to the average, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MCS _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;infectious diseases, SSGCID, human monocytic ehrlichiosis, tick diseases, thioredoxin, OXIDOREDUCTASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 27 ? THR A 36 ? GLY A 27 THR A 36 1 ? 10 HELX_P HELX_P2 2 PRO A 61 ? TYR A 70 ? PRO A 61 TYR A 70 1 ? 10 HELX_P HELX_P3 3 GLN A 85 ? GLY A 92 ? GLN A 85 GLY A 92 1 ? 8 HELX_P HELX_P4 4 ASP A 115 ? ILE A 127 ? ASP A 115 ILE A 127 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 24 ? ILE A 26 ? GLU A 24 ILE A 26 A 2 VAL A 74 ? ILE A 79 ? VAL A 74 ILE A 79 A 3 LEU A 43 ? ASP A 47 ? LEU A 43 ASP A 47 A 4 THR A 98 ? LYS A 103 ? THR A 98 LYS A 103 A 5 LYS A 106 ? ILE A 112 ? LYS A 106 ILE A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 26 ? N ILE A 26 O LYS A 78 ? O LYS A 78 A 2 3 O LYS A 75 ? O LYS A 75 N LEU A 45 ? N LEU A 45 A 3 4 N VAL A 46 ? N VAL A 46 O LEU A 100 ? O LEU A 100 A 4 5 N MET A 101 ? N MET A 101 O SER A 109 ? O SER A 109 # _atom_sites.entry_id 2MCS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ASN 128 128 128 ASN ASN A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-09-11 2 'Structure model' 1 1 2017-09-20 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_cs' 3 2 'Structure model' '_pdbx_database_status.status_code_mr' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium chloride-1' 100 ? mM ? 1 TRIS-2 20 ? mM ? 1 DTT-3 1 ? mM ? 1 entity-4 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-5' 100 ? mM ? 2 TRIS-6 20 ? mM ? 2 DTT-7 1 ? mM ? 2 entity-8 1 ? mM '[U-99% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MCS _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 60 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2319 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 75 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 75 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -113.99 78.06 2 1 LEU A 12 ? ? -173.44 147.56 3 1 GLN A 17 ? ? -108.29 40.56 4 1 PRO A 19 ? ? -69.74 -171.10 5 1 MET A 22 ? ? -179.17 106.20 6 1 PHE A 31 ? ? -46.46 -71.97 7 1 CYS A 38 ? ? -61.60 95.46 8 1 ALA A 50 ? ? -169.43 73.60 9 1 ASN A 80 ? ? -65.80 -74.46 10 1 SER A 94 ? ? -59.78 -174.37 11 1 PRO A 97 ? ? -69.80 89.79 12 1 ALA A 114 ? ? -106.06 62.66 13 2 ALA A 14 ? ? -104.60 -69.78 14 2 PRO A 19 ? ? -69.71 -171.16 15 2 SER A 21 ? ? -177.38 140.63 16 2 PHE A 31 ? ? -45.66 -72.09 17 2 CYS A 38 ? ? -60.14 96.51 18 2 PHE A 48 ? ? -59.62 -171.47 19 2 TRP A 52 ? ? -66.85 -175.50 20 2 CYS A 56 ? ? -138.99 -74.07 21 2 ARG A 57 ? ? -176.51 123.92 22 2 SER A 58 ? ? -178.32 104.90 23 2 GLU A 82 ? ? -72.87 -73.46 24 2 SER A 94 ? ? -114.67 -74.67 25 2 ALA A 95 ? ? -89.75 47.95 26 2 ILE A 96 ? ? -175.78 131.47 27 3 THR A 11 ? ? -160.42 117.09 28 3 GLN A 15 ? ? -171.81 147.13 29 3 THR A 16 ? ? -52.57 107.91 30 3 PRO A 19 ? ? -69.63 -170.83 31 3 MET A 22 ? ? -178.50 106.34 32 3 PHE A 31 ? ? -48.34 -72.92 33 3 CYS A 38 ? ? -61.49 95.88 34 3 LEU A 59 ? ? -107.51 52.86 35 3 ASN A 80 ? ? -66.74 -74.85 36 3 SER A 94 ? ? -58.84 -179.23 37 3 PRO A 97 ? ? -69.74 86.97 38 4 PHE A 31 ? ? -45.67 -72.08 39 4 CYS A 38 ? ? -59.88 97.16 40 4 TRP A 52 ? ? -62.02 96.50 41 4 CYS A 53 ? ? -127.68 -52.02 42 4 CYS A 56 ? ? -128.64 -53.15 43 4 SER A 58 ? ? 52.53 84.45 44 4 GLU A 60 ? ? 53.63 71.39 45 4 GLU A 82 ? ? -64.35 -74.55 46 5 HIS A 4 ? ? -119.79 62.51 47 5 PHE A 31 ? ? -45.71 -72.56 48 5 CYS A 38 ? ? -59.06 97.68 49 5 PHE A 48 ? ? -59.91 -172.59 50 5 CYS A 56 ? ? -59.56 -175.08 51 5 GLU A 60 ? ? -177.54 73.43 52 5 VAL A 93 ? ? -113.19 66.48 53 5 SER A 94 ? ? -70.44 -74.44 54 5 ILE A 96 ? ? 66.23 131.99 55 5 LYS A 103 ? ? -166.83 119.60 56 6 ALA A 2 ? ? -60.32 -175.10 57 6 LEU A 12 ? ? -52.41 105.31 58 6 SER A 21 ? ? -55.70 103.10 59 6 PHE A 31 ? ? -46.75 -72.63 60 6 PRO A 51 ? ? -69.80 -171.16 61 6 GLU A 60 ? ? 63.39 70.28 62 6 GLU A 82 ? ? -75.94 -72.62 63 6 VAL A 93 ? ? -110.76 63.77 64 6 ILE A 96 ? ? 66.20 131.80 65 6 LYS A 103 ? ? -166.91 118.88 66 7 GLN A 15 ? ? -69.05 99.84 67 7 PHE A 31 ? ? -45.20 -71.93 68 7 CYS A 38 ? ? -58.06 98.65 69 7 PRO A 51 ? ? -69.83 94.20 70 7 LEU A 59 ? ? -92.64 -72.82 71 7 GLU A 60 ? ? 52.05 72.49 72 7 GLU A 82 ? ? -86.44 -72.82 73 7 SER A 94 ? ? -59.62 -174.38 74 7 PRO A 97 ? ? -69.77 78.98 75 8 HIS A 3 ? ? -100.02 -64.07 76 8 GLN A 17 ? ? -58.39 106.14 77 8 PHE A 31 ? ? -45.71 -72.08 78 8 CYS A 38 ? ? -59.66 96.91 79 8 PHE A 48 ? ? -80.51 -74.88 80 8 PRO A 55 ? ? -69.71 -171.01 81 8 ARG A 57 ? ? -68.85 86.58 82 8 GLU A 60 ? ? -166.45 68.07 83 8 ASN A 80 ? ? -110.92 -73.28 84 8 GLU A 82 ? ? -51.19 -72.50 85 8 VAL A 93 ? ? -118.59 65.41 86 8 SER A 94 ? ? -95.12 40.06 87 8 ALA A 95 ? ? -170.84 120.74 88 8 ILE A 96 ? ? 66.31 131.76 89 8 SER A 109 ? ? 179.83 171.72 90 9 THR A 16 ? ? -54.04 172.43 91 9 MET A 22 ? ? -98.33 34.35 92 9 PHE A 31 ? ? -45.22 -71.99 93 9 CYS A 38 ? ? -55.91 100.25 94 9 PHE A 48 ? ? -106.09 -74.24 95 9 TRP A 49 ? ? -179.16 145.89 96 9 PRO A 51 ? ? -69.75 77.00 97 9 SER A 58 ? ? -60.37 -172.87 98 9 LEU A 59 ? ? -59.53 -174.48 99 9 GLU A 60 ? ? -49.13 107.63 100 9 GLU A 82 ? ? -68.98 -73.76 101 9 SER A 94 ? ? -58.43 -177.83 102 9 ALA A 114 ? ? -104.49 72.15 103 10 PRO A 19 ? ? -69.71 -173.55 104 10 PHE A 31 ? ? -45.45 -72.18 105 10 CYS A 53 ? ? -50.58 105.22 106 10 SER A 58 ? ? -61.71 95.68 107 10 GLU A 60 ? ? 60.87 76.47 108 10 GLU A 82 ? ? -85.63 -72.68 109 10 LYS A 103 ? ? -165.45 111.56 110 11 ALA A 2 ? ? -175.06 145.65 111 11 LEU A 12 ? ? -101.05 -66.61 112 11 GLU A 13 ? ? -120.54 -65.10 113 11 PRO A 19 ? ? -69.80 -171.73 114 11 PHE A 31 ? ? -46.50 -72.46 115 11 CYS A 38 ? ? -55.00 100.87 116 11 PRO A 51 ? ? -69.78 -171.87 117 11 CYS A 56 ? ? -53.18 171.25 118 11 GLU A 60 ? ? -178.36 73.80 119 11 GLU A 82 ? ? -86.28 -72.54 120 12 PHE A 31 ? ? -45.50 -72.04 121 12 CYS A 38 ? ? -63.89 97.23 122 12 ALA A 50 ? ? 63.59 160.41 123 12 SER A 58 ? ? -80.03 -74.31 124 12 GLU A 60 ? ? -50.75 108.79 125 12 GLU A 82 ? ? -87.30 -73.68 126 12 SER A 109 ? ? 179.90 171.99 127 13 LEU A 12 ? ? -156.17 31.41 128 13 PHE A 31 ? ? -48.21 -73.06 129 13 CYS A 38 ? ? -57.63 99.16 130 13 PHE A 48 ? ? -59.64 -172.03 131 13 ALA A 50 ? ? -172.81 73.07 132 13 PRO A 51 ? ? -69.68 -178.40 133 13 TRP A 52 ? ? -54.62 104.36 134 13 ARG A 57 ? ? -96.84 -74.54 135 13 GLU A 60 ? ? -176.46 67.47 136 13 GLU A 82 ? ? -81.56 -72.98 137 13 SER A 94 ? ? -73.20 -74.75 138 13 ALA A 95 ? ? -110.19 74.62 139 13 ILE A 96 ? ? -175.86 131.62 140 13 SER A 109 ? ? 179.66 171.81 141 13 ALA A 114 ? ? -107.44 69.93 142 14 ALA A 2 ? ? -72.17 -71.98 143 14 MET A 9 ? ? -59.15 173.66 144 14 PRO A 19 ? ? -69.72 -173.96 145 14 PHE A 31 ? ? -46.86 -73.05 146 14 CYS A 38 ? ? -66.95 88.60 147 14 SER A 58 ? ? -172.35 111.88 148 14 VAL A 93 ? ? -94.48 -76.93 149 14 ALA A 95 ? ? 179.37 138.85 150 14 ILE A 96 ? ? 65.39 135.51 151 14 PRO A 97 ? ? -69.71 74.10 152 14 SER A 109 ? ? 178.95 171.86 153 15 GLN A 17 ? ? -162.28 112.41 154 15 MET A 22 ? ? -177.29 105.13 155 15 PHE A 31 ? ? -45.64 -71.93 156 15 CYS A 38 ? ? -65.36 90.69 157 15 PRO A 51 ? ? -69.79 -171.10 158 15 TRP A 52 ? ? -101.92 61.35 159 15 CYS A 53 ? ? -131.94 -74.64 160 15 PRO A 55 ? ? -69.82 -170.84 161 15 GLU A 60 ? ? 60.07 73.88 162 15 ASN A 84 ? ? -142.34 43.59 163 15 SER A 94 ? ? -98.61 -74.69 164 15 ALA A 95 ? ? -116.27 77.46 165 15 ILE A 96 ? ? -175.60 131.58 166 15 PRO A 97 ? ? -69.75 92.39 167 15 SER A 109 ? ? 179.29 171.66 168 16 ALA A 2 ? ? -171.89 144.73 169 16 HIS A 5 ? ? -98.51 37.00 170 16 GLN A 17 ? ? -51.99 -73.22 171 16 MET A 22 ? ? -132.18 -40.48 172 16 PHE A 31 ? ? -45.25 -72.40 173 16 ASP A 40 ? ? -94.03 35.92 174 16 TRP A 49 ? ? -174.61 108.55 175 16 ALA A 50 ? ? -167.81 74.00 176 16 PRO A 51 ? ? -69.83 78.79 177 16 LEU A 59 ? ? -91.44 -66.00 178 16 GLU A 60 ? ? 63.28 72.90 179 16 ILE A 81 ? ? -61.01 95.38 180 16 GLU A 82 ? ? -85.87 -72.59 181 16 SER A 94 ? ? -69.38 -173.53 182 16 PRO A 97 ? ? -69.73 78.76 183 17 PHE A 31 ? ? -45.94 -72.45 184 17 CYS A 38 ? ? -60.36 96.44 185 17 CYS A 53 ? ? -101.73 66.60 186 17 SER A 58 ? ? -178.25 146.90 187 17 GLU A 60 ? ? -119.40 73.21 188 17 GLU A 82 ? ? -86.86 -73.04 189 17 SER A 94 ? ? -52.37 170.83 190 17 SER A 109 ? ? 178.44 171.69 191 18 PHE A 31 ? ? -44.38 -71.78 192 18 CYS A 38 ? ? -59.76 96.90 193 18 PHE A 48 ? ? -118.08 50.34 194 18 ALA A 50 ? ? 63.94 160.34 195 18 ASN A 80 ? ? -69.61 -74.93 196 18 ASN A 84 ? ? -162.98 104.79 197 18 ILE A 96 ? ? 65.39 134.69 198 18 PRO A 97 ? ? -69.80 88.67 199 19 MET A 9 ? ? -168.73 119.48 200 19 LEU A 12 ? ? -132.30 -59.59 201 19 ALA A 14 ? ? -119.43 57.33 202 19 PRO A 19 ? ? -69.73 -178.85 203 19 MET A 22 ? ? -112.26 -74.40 204 19 PHE A 31 ? ? -46.45 -72.45 205 19 CYS A 38 ? ? -61.92 94.95 206 19 TRP A 49 ? ? -91.46 56.49 207 19 ALA A 50 ? ? -174.25 68.19 208 19 TRP A 52 ? ? -140.32 -67.78 209 19 PRO A 55 ? ? -69.76 -170.94 210 19 ARG A 57 ? ? -56.77 -74.35 211 19 GLU A 60 ? ? 52.40 73.84 212 19 GLU A 82 ? ? -85.52 -72.83 213 19 ALA A 95 ? ? -60.93 -169.14 214 19 ILE A 96 ? ? 57.22 160.34 215 20 HIS A 4 ? ? -173.00 130.36 216 20 HIS A 6 ? ? -160.26 115.78 217 20 ALA A 14 ? ? -104.66 47.60 218 20 PRO A 19 ? ? -69.79 -174.73 219 20 PHE A 31 ? ? -47.77 -72.87 220 20 CYS A 38 ? ? -59.91 97.94 221 20 PRO A 55 ? ? -69.79 78.97 222 20 GLU A 60 ? ? -118.46 73.50 223 20 SER A 94 ? ? -56.79 179.43 224 20 ASP A 115 ? ? -170.62 105.98 #