data_2MD0 # _entry.id 2MD0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MD0 pdb_00002md0 10.2210/pdb2md0/pdb RCSB RCSB103490 ? ? BMRB 19460 ? ? WWPDB D_1000103490 ? ? # _pdbx_database_related.db_id 19460 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MD0 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-08-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chhabra, S.' 1 'Swarbrick, J.D.' 2 'Mohanty, B.' 3 'Chang, S.C.' 4 'Chandy, G.K.' 5 'Pennington, M.W.' 6 'Norton, R.S.' 7 # _citation.id primary _citation.title 'Kv1.3 channel-blocking immunomodulatory peptides from parasitic worms: implications for autoimmune diseases.' _citation.journal_abbrev 'Faseb J.' _citation.journal_volume 28 _citation.page_first 3952 _citation.page_last 3964 _citation.year 2014 _citation.journal_id_ASTM FAJOEC _citation.country US _citation.journal_id_ISSN 0892-6638 _citation.journal_id_CSD 2074 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24891519 _citation.pdbx_database_id_DOI 10.1096/fj.14-251967 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chhabra, S.' 1 ? primary 'Chang, S.C.' 2 ? primary 'Nguyen, H.M.' 3 ? primary 'Huq, R.' 4 ? primary 'Tanner, M.R.' 5 ? primary 'Londono, L.M.' 6 ? primary 'Estrada, R.' 7 ? primary 'Dhawan, V.' 8 ? primary 'Chauhan, S.' 9 ? primary 'Upadhyay, S.K.' 10 ? primary 'Gindin, M.' 11 ? primary 'Hotez, P.J.' 12 ? primary 'Valenzuela, J.G.' 13 ? primary 'Mohanty, B.' 14 ? primary 'Swarbrick, J.D.' 15 ? primary 'Wulff, H.' 16 ? primary 'Iadonato, S.P.' 17 ? primary 'Gutman, G.A.' 18 ? primary 'Beeton, C.' 19 ? primary 'Pennington, M.W.' 20 ? primary 'Norton, R.S.' 21 ? primary 'Chandy, K.G.' 22 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description AcK1 _entity.formula_weight 5858.475 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NDIRTAADMEHCADEKNFDCRRSLRNGDCDNDDKLLEMGYYCPVTCGFCEP _entity_poly.pdbx_seq_one_letter_code_can NDIRTAADMEHCADEKNFDCRRSLRNGDCDNDDKLLEMGYYCPVTCGFCEP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 ASP n 1 3 ILE n 1 4 ARG n 1 5 THR n 1 6 ALA n 1 7 ALA n 1 8 ASP n 1 9 MET n 1 10 GLU n 1 11 HIS n 1 12 CYS n 1 13 ALA n 1 14 ASP n 1 15 GLU n 1 16 LYS n 1 17 ASN n 1 18 PHE n 1 19 ASP n 1 20 CYS n 1 21 ARG n 1 22 ARG n 1 23 SER n 1 24 LEU n 1 25 ARG n 1 26 ASN n 1 27 GLY n 1 28 ASP n 1 29 CYS n 1 30 ASP n 1 31 ASN n 1 32 ASP n 1 33 ASP n 1 34 LYS n 1 35 LEU n 1 36 LEU n 1 37 GLU n 1 38 MET n 1 39 GLY n 1 40 TYR n 1 41 TYR n 1 42 CYS n 1 43 PRO n 1 44 VAL n 1 45 THR n 1 46 CYS n 1 47 GLY n 1 48 PHE n 1 49 CYS n 1 50 GLU n 1 51 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ancylostoma caninum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29170 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2MD0 _struct_ref.pdbx_db_accession 2MD0 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MD0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2MD0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 51 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 51 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '3D HNCO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] entity, 10 mM sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' 600 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MD0 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MD0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MD0 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Bartels et al.' 'chemical shift assignment' XEASY ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 CCPN 'data analysis' CcpNmr ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MD0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MD0 _struct.title 'Solution structure of ShK-like immunomodulatory peptide from Ancylostoma caninum (hookworm)' _struct.pdbx_model_details 'closest to the average, model4' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MD0 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'hookworm, ShK-like peptide, Kv1.3, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? ALA A 6 ? ASP A 2 ALA A 6 5 ? 5 HELX_P HELX_P2 2 ASP A 19 ? ASN A 26 ? ASP A 19 ASN A 26 1 ? 8 HELX_P HELX_P3 3 GLY A 27 ? ASP A 30 ? GLY A 27 ASP A 30 5 ? 4 HELX_P HELX_P4 4 ASN A 31 ? CYS A 42 ? ASN A 31 CYS A 42 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 12 A CYS 49 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 20 A CYS 42 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 29 A CYS 46 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2MD0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 PRO 51 51 51 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-02 2 'Structure model' 1 1 2015-04-08 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 10 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 37 ? ? H A TYR 41 ? ? 1.52 2 2 O A GLU 37 ? ? H A TYR 41 ? ? 1.54 3 3 O A GLU 37 ? ? H A TYR 41 ? ? 1.48 4 4 HZ1 A LYS 16 ? ? HD22 A ASN 17 ? ? 1.32 5 4 O A GLU 37 ? ? H A TYR 41 ? ? 1.58 6 5 O A GLU 37 ? ? H A TYR 41 ? ? 1.52 7 5 O A CYS 20 ? ? H A LEU 24 ? ? 1.55 8 6 O A GLU 37 ? ? H A TYR 41 ? ? 1.50 9 7 O A GLU 37 ? ? H A TYR 41 ? ? 1.52 10 7 O A CYS 20 ? ? H A LEU 24 ? ? 1.58 11 8 O A GLU 37 ? ? H A TYR 41 ? ? 1.54 12 9 OD1 A ASP 8 ? ? H A GLU 10 ? ? 1.52 13 9 O A GLU 37 ? ? H A TYR 41 ? ? 1.58 14 10 O A GLU 37 ? ? H A TYR 41 ? ? 1.50 15 11 O A GLU 37 ? ? H A TYR 41 ? ? 1.47 16 12 O A GLU 37 ? ? H A TYR 41 ? ? 1.54 17 12 OD1 A ASP 8 ? ? H A GLU 10 ? ? 1.57 18 13 O A GLU 37 ? ? H A TYR 41 ? ? 1.59 19 14 O A GLU 37 ? ? H A TYR 41 ? ? 1.50 20 15 O A GLU 37 ? ? H A TYR 41 ? ? 1.51 21 16 O A GLU 37 ? ? H A TYR 41 ? ? 1.51 22 17 HZ1 A LYS 16 ? ? HD22 A ASN 17 ? ? 1.23 23 17 O A GLU 37 ? ? H A TYR 41 ? ? 1.48 24 18 O A GLU 37 ? ? H A TYR 41 ? ? 1.59 25 19 O A GLU 37 ? ? H A TYR 41 ? ? 1.53 26 19 O A CYS 20 ? ? H A LEU 24 ? ? 1.56 27 20 O A GLU 37 ? ? H A TYR 41 ? ? 1.54 28 20 O A CYS 20 ? ? H A LEU 24 ? ? 1.59 29 21 HE A ARG 22 ? ? HH21 A ARG 25 ? ? 1.29 30 21 O A GLU 37 ? ? H A TYR 41 ? ? 1.53 31 21 OE1 A GLU 15 ? ? O A TYR 41 ? ? 2.19 32 22 O A GLU 37 ? ? H A TYR 41 ? ? 1.53 33 22 O A CYS 20 ? ? H A LEU 24 ? ? 1.60 34 23 O A GLU 37 ? ? H A TYR 41 ? ? 1.51 35 24 O A GLU 37 ? ? H A TYR 41 ? ? 1.44 36 24 O A CYS 20 ? ? H A LEU 24 ? ? 1.54 37 25 O A GLU 37 ? ? H A TYR 41 ? ? 1.49 38 25 O A CYS 20 ? ? H A LEU 24 ? ? 1.59 39 25 OE1 A GLU 15 ? ? O A TYR 41 ? ? 2.13 40 26 O A GLU 37 ? ? H A TYR 41 ? ? 1.56 41 27 O A GLU 37 ? ? H A TYR 41 ? ? 1.46 42 28 O A GLU 37 ? ? H A TYR 41 ? ? 1.53 43 29 O A GLU 37 ? ? H A TYR 41 ? ? 1.51 44 30 HE A ARG 21 ? ? HH21 A ARG 25 ? ? 1.27 45 30 HZ2 A LYS 16 ? ? HD22 A ASN 17 ? ? 1.27 46 30 O A GLU 37 ? ? H A TYR 41 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 5 MET A 9 ? ? 46.15 18.38 2 6 MET A 9 ? ? -68.21 12.54 3 7 ASP A 2 ? ? 54.36 123.21 4 8 ALA A 7 ? ? 48.37 -177.85 5 8 ASP A 8 ? ? -150.98 4.07 6 9 THR A 5 ? ? -65.62 5.71 7 9 MET A 9 ? ? 42.43 23.29 8 12 ASP A 8 ? ? -147.83 14.89 9 12 MET A 9 ? ? 56.88 17.97 10 13 MET A 9 ? ? -65.80 13.79 11 14 ALA A 7 ? ? 55.00 154.10 12 14 MET A 9 ? ? 47.15 18.27 13 15 MET A 9 ? ? 41.78 17.11 14 16 ASP A 8 ? ? -161.03 1.48 15 16 MET A 9 ? ? 48.69 15.38 16 17 MET A 9 ? ? 47.24 21.17 17 18 ALA A 7 ? ? 54.39 124.62 18 18 MET A 9 ? ? 48.89 20.41 19 19 MET A 9 ? ? -65.97 14.66 20 20 MET A 9 ? ? -65.19 14.19 21 21 ALA A 7 ? ? 48.83 -179.89 22 23 MET A 9 ? ? 49.95 17.84 23 25 ALA A 7 ? ? 44.58 -166.09 24 28 ALA A 6 ? ? 33.21 51.35 25 28 ASP A 8 ? ? -162.50 0.80 26 28 MET A 9 ? ? 44.69 21.81 27 30 ASP A 2 ? ? 56.43 125.16 #