data_2MEO # _entry.id 2MEO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MEO pdb_00002meo 10.2210/pdb2meo/pdb RCSB RCSB103537 ? ? BMRB 19528 ? 10.13018/BMR19528 WWPDB D_1000103537 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-28 2 'Structure model' 1 1 2014-07-02 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MEO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-09-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2ME7 PDB . unspecified 2MEL PDB . unspecified 2MEN PDB . unspecified 19528 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'del Rio-Portilla, F.' 1 'Ramirez-Cordero, B.' 2 # _citation.id primary _citation.title 'Cytotoxicity of recombinant tamapin and related toxin-like peptides on model cell lines.' _citation.journal_abbrev Chem.Res.Toxicol. _citation.journal_volume 27 _citation.page_first 960 _citation.page_last 967 _citation.year 2014 _citation.journal_id_ASTM CRTOEC _citation.country US _citation.journal_id_ISSN 0893-228X _citation.journal_id_CSD 2140 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24821061 _citation.pdbx_database_id_DOI 10.1021/tx4004193 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramirez-Cordero, B.' 1 ? primary 'Toledano, Y.' 2 ? primary 'Cano-Sanchez, P.' 3 ? primary 'Hernandez-Lopez, R.' 4 ? primary 'Flores-Solis, D.' 5 ? primary 'Saucedo-Yanez, A.L.' 6 ? primary 'Chavez-Uribe, I.' 7 ? primary 'Brieba, L.G.' 8 ? primary 'Del Rio-Portilla, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Potassium channel toxin alpha-KTx 5.4' _entity.formula_weight 3442.083 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'R8A, R9A' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Tamapin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSAFCNLAACELSCRSLGLLGKCIGEECKCVPY _entity_poly.pdbx_seq_one_letter_code_can GSAFCNLAACELSCRSLGLLGKCIGEECKCVPY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 PHE n 1 5 CYS n 1 6 ASN n 1 7 LEU n 1 8 ALA n 1 9 ALA n 1 10 CYS n 1 11 GLU n 1 12 LEU n 1 13 SER n 1 14 CYS n 1 15 ARG n 1 16 SER n 1 17 LEU n 1 18 GLY n 1 19 LEU n 1 20 LEU n 1 21 GLY n 1 22 LYS n 1 23 CYS n 1 24 ILE n 1 25 GLY n 1 26 GLU n 1 27 GLU n 1 28 CYS n 1 29 LYS n 1 30 CYS n 1 31 VAL n 1 32 PRO n 1 33 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'eastern Indian scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mesobuthus tamulus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34647 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'modified pEt32a' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MEO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MEO _struct.title 'NMR solution structure of the double GS-Tamapin mutation R6A/R7A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MEO _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Scorpion toxin, tamapin, alpha KTx5.4 double mutant R6A R7A, Toxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KAX54_MESTA _struct_ref.pdbx_db_accession P59869 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AFCNLRRCELSCRSLGLLGKCIGEECKCVPY _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MEO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P59869 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MEO GLY A 1 ? UNP P59869 ? ? 'expression tag' 1 1 1 2MEO SER A 2 ? UNP P59869 ? ? 'expression tag' 2 2 1 2MEO ALA A 8 ? UNP P59869 ARG 6 'engineered mutation' 8 3 1 2MEO ALA A 9 ? UNP P59869 ARG 7 'engineered mutation' 9 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 6 ? LEU A 12 ? ASN A 6 LEU A 12 1 ? 7 HELX_P HELX_P2 2 SER A 13 ? GLY A 18 ? SER A 13 GLY A 18 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 5 A CYS 23 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 10 A CYS 28 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 14 A CYS 30 1_555 ? ? ? ? ? ? ? 2.040 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 23 ? CYS A 5 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 28 ? CYS A 10 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 14 ? CYS A 30 ? CYS A 14 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 1 A . ? GLY 1 A SER 2 A ? SER 2 A 1 -0.95 2 SER 2 A . ? SER 2 A ALA 3 A ? ALA 3 A 1 -13.43 3 GLY 1 A . ? GLY 1 A SER 2 A ? SER 2 A 2 1.58 4 GLY 1 A . ? GLY 1 A SER 2 A ? SER 2 A 7 6.12 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 21 ? ILE A 24 ? GLY A 21 ILE A 24 A 2 GLU A 27 ? CYS A 30 ? GLU A 27 CYS A 30 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 22 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # _pdbx_entry_details.entry_id 2MEO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 3 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 2 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 26 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CA A CYS 30 ? ? CB A CYS 30 ? ? SG A CYS 30 ? ? 121.50 114.20 7.30 1.10 N 2 3 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 125.04 120.30 4.74 0.50 N 3 4 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.12 120.30 3.82 0.50 N 4 5 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.16 120.30 3.86 0.50 N 5 6 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.04 120.30 3.74 0.50 N 6 7 CA A CYS 30 ? ? CB A CYS 30 ? ? SG A CYS 30 ? ? 120.96 114.20 6.76 1.10 N 7 8 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.89 120.30 3.59 0.50 N 8 9 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.45 120.30 3.15 0.50 N 9 11 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.74 120.30 3.44 0.50 N 10 12 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.20 120.30 3.90 0.50 N 11 13 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.99 120.30 3.69 0.50 N 12 14 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.75 120.30 3.45 0.50 N 13 15 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.48 120.30 4.18 0.50 N 14 17 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.40 120.30 4.10 0.50 N 15 19 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 125.11 120.30 4.81 0.50 N 16 20 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.87 120.30 3.57 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 14 ? ? -133.03 -45.08 2 2 ALA A 3 ? ? 36.67 71.27 3 2 CYS A 10 ? ? -123.38 -57.40 4 3 PHE A 4 ? ? 59.20 162.29 5 3 CYS A 5 ? ? -75.60 28.94 6 4 PHE A 4 ? ? 71.11 149.76 7 4 LEU A 7 ? ? -149.62 -22.54 8 4 GLU A 26 ? ? 58.20 13.11 9 6 GLU A 26 ? ? 58.11 5.46 10 7 SER A 2 ? ? 57.90 160.23 11 7 CYS A 14 ? ? -130.65 -32.97 12 7 GLU A 26 ? ? -150.33 -58.13 13 11 ALA A 3 ? ? -159.85 4.20 14 11 PHE A 4 ? ? 57.70 138.40 15 11 ASN A 6 ? ? -87.93 37.44 16 11 LEU A 19 ? ? -124.10 -165.90 17 13 ALA A 3 ? ? -146.10 47.40 18 14 SER A 2 ? ? -142.27 -0.49 19 14 ILE A 24 ? ? -137.74 -45.97 20 15 LEU A 7 ? ? -149.61 -7.67 21 15 PRO A 32 ? ? -65.79 13.61 22 16 ASN A 6 ? ? -78.09 45.89 23 18 PHE A 4 ? ? 63.61 162.49 24 18 LEU A 7 ? ? -130.30 -61.16 25 19 SER A 2 ? ? 63.78 -30.58 26 20 PRO A 32 ? ? -84.70 41.15 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 7 _pdbx_validate_peptide_omega.auth_comp_id_1 CYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 30 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 VAL _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 31 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.68 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MEO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MEO _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '3.0 mM protein, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample.component entity-1 _pdbx_nmr_exptl_sample.concentration 3.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 2.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D DQF-COSY' 1 3 1 '2D 1H-1H NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MEO _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 517 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count 108 _pdbx_nmr_constraints.NOE_medium_range_total_count 108 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2MEO _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement Amber 99 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Bartels et al.' 'chemical shift assignment' XEASY ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLU N N N N 72 GLU CA C N S 73 GLU C C N N 74 GLU O O N N 75 GLU CB C N N 76 GLU CG C N N 77 GLU CD C N N 78 GLU OE1 O N N 79 GLU OE2 O N N 80 GLU OXT O N N 81 GLU H H N N 82 GLU H2 H N N 83 GLU HA H N N 84 GLU HB2 H N N 85 GLU HB3 H N N 86 GLU HG2 H N N 87 GLU HG3 H N N 88 GLU HE2 H N N 89 GLU HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 ILE N N N N 101 ILE CA C N S 102 ILE C C N N 103 ILE O O N N 104 ILE CB C N S 105 ILE CG1 C N N 106 ILE CG2 C N N 107 ILE CD1 C N N 108 ILE OXT O N N 109 ILE H H N N 110 ILE H2 H N N 111 ILE HA H N N 112 ILE HB H N N 113 ILE HG12 H N N 114 ILE HG13 H N N 115 ILE HG21 H N N 116 ILE HG22 H N N 117 ILE HG23 H N N 118 ILE HD11 H N N 119 ILE HD12 H N N 120 ILE HD13 H N N 121 ILE HXT H N N 122 LEU N N N N 123 LEU CA C N S 124 LEU C C N N 125 LEU O O N N 126 LEU CB C N N 127 LEU CG C N N 128 LEU CD1 C N N 129 LEU CD2 C N N 130 LEU OXT O N N 131 LEU H H N N 132 LEU H2 H N N 133 LEU HA H N N 134 LEU HB2 H N N 135 LEU HB3 H N N 136 LEU HG H N N 137 LEU HD11 H N N 138 LEU HD12 H N N 139 LEU HD13 H N N 140 LEU HD21 H N N 141 LEU HD22 H N N 142 LEU HD23 H N N 143 LEU HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 PHE N N N N 170 PHE CA C N S 171 PHE C C N N 172 PHE O O N N 173 PHE CB C N N 174 PHE CG C Y N 175 PHE CD1 C Y N 176 PHE CD2 C Y N 177 PHE CE1 C Y N 178 PHE CE2 C Y N 179 PHE CZ C Y N 180 PHE OXT O N N 181 PHE H H N N 182 PHE H2 H N N 183 PHE HA H N N 184 PHE HB2 H N N 185 PHE HB3 H N N 186 PHE HD1 H N N 187 PHE HD2 H N N 188 PHE HE1 H N N 189 PHE HE2 H N N 190 PHE HZ H N N 191 PHE HXT H N N 192 PRO N N N N 193 PRO CA C N S 194 PRO C C N N 195 PRO O O N N 196 PRO CB C N N 197 PRO CG C N N 198 PRO CD C N N 199 PRO OXT O N N 200 PRO H H N N 201 PRO HA H N N 202 PRO HB2 H N N 203 PRO HB3 H N N 204 PRO HG2 H N N 205 PRO HG3 H N N 206 PRO HD2 H N N 207 PRO HD3 H N N 208 PRO HXT H N N 209 SER N N N N 210 SER CA C N S 211 SER C C N N 212 SER O O N N 213 SER CB C N N 214 SER OG O N N 215 SER OXT O N N 216 SER H H N N 217 SER H2 H N N 218 SER HA H N N 219 SER HB2 H N N 220 SER HB3 H N N 221 SER HG H N N 222 SER HXT H N N 223 TYR N N N N 224 TYR CA C N S 225 TYR C C N N 226 TYR O O N N 227 TYR CB C N N 228 TYR CG C Y N 229 TYR CD1 C Y N 230 TYR CD2 C Y N 231 TYR CE1 C Y N 232 TYR CE2 C Y N 233 TYR CZ C Y N 234 TYR OH O N N 235 TYR OXT O N N 236 TYR H H N N 237 TYR H2 H N N 238 TYR HA H N N 239 TYR HB2 H N N 240 TYR HB3 H N N 241 TYR HD1 H N N 242 TYR HD2 H N N 243 TYR HE1 H N N 244 TYR HE2 H N N 245 TYR HH H N N 246 TYR HXT H N N 247 VAL N N N N 248 VAL CA C N S 249 VAL C C N N 250 VAL O O N N 251 VAL CB C N N 252 VAL CG1 C N N 253 VAL CG2 C N N 254 VAL OXT O N N 255 VAL H H N N 256 VAL H2 H N N 257 VAL HA H N N 258 VAL HB H N N 259 VAL HG11 H N N 260 VAL HG12 H N N 261 VAL HG13 H N N 262 VAL HG21 H N N 263 VAL HG22 H N N 264 VAL HG23 H N N 265 VAL HXT H N N 266 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLU N CA sing N N 68 GLU N H sing N N 69 GLU N H2 sing N N 70 GLU CA C sing N N 71 GLU CA CB sing N N 72 GLU CA HA sing N N 73 GLU C O doub N N 74 GLU C OXT sing N N 75 GLU CB CG sing N N 76 GLU CB HB2 sing N N 77 GLU CB HB3 sing N N 78 GLU CG CD sing N N 79 GLU CG HG2 sing N N 80 GLU CG HG3 sing N N 81 GLU CD OE1 doub N N 82 GLU CD OE2 sing N N 83 GLU OE2 HE2 sing N N 84 GLU OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 ILE N CA sing N N 95 ILE N H sing N N 96 ILE N H2 sing N N 97 ILE CA C sing N N 98 ILE CA CB sing N N 99 ILE CA HA sing N N 100 ILE C O doub N N 101 ILE C OXT sing N N 102 ILE CB CG1 sing N N 103 ILE CB CG2 sing N N 104 ILE CB HB sing N N 105 ILE CG1 CD1 sing N N 106 ILE CG1 HG12 sing N N 107 ILE CG1 HG13 sing N N 108 ILE CG2 HG21 sing N N 109 ILE CG2 HG22 sing N N 110 ILE CG2 HG23 sing N N 111 ILE CD1 HD11 sing N N 112 ILE CD1 HD12 sing N N 113 ILE CD1 HD13 sing N N 114 ILE OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 PHE N CA sing N N 161 PHE N H sing N N 162 PHE N H2 sing N N 163 PHE CA C sing N N 164 PHE CA CB sing N N 165 PHE CA HA sing N N 166 PHE C O doub N N 167 PHE C OXT sing N N 168 PHE CB CG sing N N 169 PHE CB HB2 sing N N 170 PHE CB HB3 sing N N 171 PHE CG CD1 doub Y N 172 PHE CG CD2 sing Y N 173 PHE CD1 CE1 sing Y N 174 PHE CD1 HD1 sing N N 175 PHE CD2 CE2 doub Y N 176 PHE CD2 HD2 sing N N 177 PHE CE1 CZ doub Y N 178 PHE CE1 HE1 sing N N 179 PHE CE2 CZ sing Y N 180 PHE CE2 HE2 sing N N 181 PHE CZ HZ sing N N 182 PHE OXT HXT sing N N 183 PRO N CA sing N N 184 PRO N CD sing N N 185 PRO N H sing N N 186 PRO CA C sing N N 187 PRO CA CB sing N N 188 PRO CA HA sing N N 189 PRO C O doub N N 190 PRO C OXT sing N N 191 PRO CB CG sing N N 192 PRO CB HB2 sing N N 193 PRO CB HB3 sing N N 194 PRO CG CD sing N N 195 PRO CG HG2 sing N N 196 PRO CG HG3 sing N N 197 PRO CD HD2 sing N N 198 PRO CD HD3 sing N N 199 PRO OXT HXT sing N N 200 SER N CA sing N N 201 SER N H sing N N 202 SER N H2 sing N N 203 SER CA C sing N N 204 SER CA CB sing N N 205 SER CA HA sing N N 206 SER C O doub N N 207 SER C OXT sing N N 208 SER CB OG sing N N 209 SER CB HB2 sing N N 210 SER CB HB3 sing N N 211 SER OG HG sing N N 212 SER OXT HXT sing N N 213 TYR N CA sing N N 214 TYR N H sing N N 215 TYR N H2 sing N N 216 TYR CA C sing N N 217 TYR CA CB sing N N 218 TYR CA HA sing N N 219 TYR C O doub N N 220 TYR C OXT sing N N 221 TYR CB CG sing N N 222 TYR CB HB2 sing N N 223 TYR CB HB3 sing N N 224 TYR CG CD1 doub Y N 225 TYR CG CD2 sing Y N 226 TYR CD1 CE1 sing Y N 227 TYR CD1 HD1 sing N N 228 TYR CD2 CE2 doub Y N 229 TYR CD2 HD2 sing N N 230 TYR CE1 CZ doub Y N 231 TYR CE1 HE1 sing N N 232 TYR CE2 CZ sing Y N 233 TYR CE2 HE2 sing N N 234 TYR CZ OH sing N N 235 TYR OH HH sing N N 236 TYR OXT HXT sing N N 237 VAL N CA sing N N 238 VAL N H sing N N 239 VAL N H2 sing N N 240 VAL CA C sing N N 241 VAL CA CB sing N N 242 VAL CA HA sing N N 243 VAL C O doub N N 244 VAL C OXT sing N N 245 VAL CB CG1 sing N N 246 VAL CB CG2 sing N N 247 VAL CB HB sing N N 248 VAL CG1 HG11 sing N N 249 VAL CG1 HG12 sing N N 250 VAL CG1 HG13 sing N N 251 VAL CG2 HG21 sing N N 252 VAL CG2 HG22 sing N N 253 VAL CG2 HG23 sing N N 254 VAL OXT HXT sing N N 255 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2MEO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_