data_2MFE # _entry.id 2MFE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MFE RCSB RCSB103562 BMRB 19546 WWPDB D_1000103562 # _pdbx_database_related.db_id 19546 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MFE _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-10-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Duss, O.' 1 'Diarra Dit Konte, N.' 2 'Michel, E.' 3 'Schubert, M.' 4 'Allain, F.H.-T.' 5 # _citation.id primary _citation.title 'Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 42 _citation.page_first 5332 _citation.page_last 5346 _citation.year 2014 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24561806 _citation.pdbx_database_id_DOI 10.1093/nar/gku141 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Duss, O.' 1 primary 'Michel, E.' 2 primary 'Diarra Dit Konte, N.' 3 primary 'Schubert, M.' 4 primary 'Allain, F.H.' 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Carbon storage regulator homolog' 7847.951 2 ? ? ? ? 2 polymer syn 'SL2(RsmZ) RNA' 7112.307 2 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH A,C ? 2 polyribonucleotide no no GGGCCAUCAAGGACGAUGGUCC GGGCCAUCAAGGACGAUGGUCC B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 ILE n 1 4 LEU n 1 5 THR n 1 6 ARG n 1 7 LYS n 1 8 VAL n 1 9 GLY n 1 10 GLU n 1 11 SER n 1 12 ILE n 1 13 ASN n 1 14 ILE n 1 15 GLY n 1 16 ASP n 1 17 ASP n 1 18 ILE n 1 19 THR n 1 20 ILE n 1 21 THR n 1 22 ILE n 1 23 LEU n 1 24 GLY n 1 25 VAL n 1 26 SER n 1 27 GLY n 1 28 GLN n 1 29 GLN n 1 30 VAL n 1 31 ARG n 1 32 ILE n 1 33 GLY n 1 34 ILE n 1 35 ASN n 1 36 ALA n 1 37 PRO n 1 38 LYS n 1 39 ASP n 1 40 VAL n 1 41 ALA n 1 42 VAL n 1 43 HIS n 1 44 ARG n 1 45 GLU n 1 46 GLU n 1 47 ILE n 1 48 TYR n 1 49 GLN n 1 50 ARG n 1 51 ILE n 1 52 GLN n 1 53 ALA n 1 54 GLY n 1 55 LEU n 1 56 THR n 1 57 ALA n 1 58 PRO n 1 59 ASP n 1 60 LYS n 1 61 ARG n 1 62 GLU n 1 63 THR n 1 64 PRO n 1 65 HIS n 1 66 HIS n 1 67 HIS n 1 68 HIS n 1 69 HIS n 1 70 HIS n 2 1 G n 2 2 G n 2 3 G n 2 4 C n 2 5 C n 2 6 A n 2 7 U n 2 8 C n 2 9 A n 2 10 A n 2 11 G n 2 12 G n 2 13 A n 2 14 C n 2 15 G n 2 16 A n 2 17 U n 2 18 G n 2 19 G n 2 20 U n 2 21 C n 2 22 C n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rsmE, csrA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas fluorescens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 294 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP Q5MXB2_PSEFL Q5MXB2 1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD 1 ? 2 PDB 2MFE 2MFE 2 GGGCCAUCAAGGACGAUGGUCC ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2MFE A 1 ? 59 ? Q5MXB2 1 ? 59 ? 1 59 2 1 2MFE C 1 ? 59 ? Q5MXB2 1 ? 59 ? 1 59 3 2 2MFE B 1 ? 22 ? 2MFE 17 ? 38 ? 17 38 4 2 2MFE D 1 ? 22 ? 2MFE 17 ? 38 ? 17 38 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MFE LYS A 60 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 60 1 1 2MFE ARG A 61 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 61 2 1 2MFE GLU A 62 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 62 3 1 2MFE THR A 63 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 63 4 1 2MFE PRO A 64 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 64 5 1 2MFE HIS A 65 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 65 6 1 2MFE HIS A 66 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 66 7 1 2MFE HIS A 67 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 67 8 1 2MFE HIS A 68 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 68 9 1 2MFE HIS A 69 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 69 10 1 2MFE HIS A 70 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 70 11 2 2MFE LYS C 60 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 60 12 2 2MFE ARG C 61 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 61 13 2 2MFE GLU C 62 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 62 14 2 2MFE THR C 63 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 63 15 2 2MFE PRO C 64 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 64 16 2 2MFE HIS C 65 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 65 17 2 2MFE HIS C 66 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 66 18 2 2MFE HIS C 67 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 67 19 2 2MFE HIS C 68 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 68 20 2 2MFE HIS C 69 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 69 21 2 2MFE HIS C 70 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 70 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H NOESY' 1 5 4 '2D 1H-13C HSQC' 1 6 3 '3D 1H-13C NOESY aliphatic' 1 7 4 '3D 1Fe3Ff NOESY' 1 8 4 '3D HCCH-TOCSY' 1 9 3 '3D HNCA' 1 10 3 '3D HNCACB' 1 11 2 '2D 1H-1H TOCSY' 1 12 5 '2D 1H-15N HSQC' 1 13 7 '2D 1H-15N HSQC' 1 14 6 '2D 1H-13C HSQC' 1 15 8 '2D 1H-13C HSQC' 1 16 6 '3D 1H-13C NOESY' 1 17 8 '3D 1H-13C NOESY' 1 18 6 '3D 1Fe3Ff NOESY' 1 19 8 '3D 1Fe3Ff NOESY' 1 20 6 '3D HCCH-TOCSY' 1 21 8 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.18 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 15N] RsmE, 1 mM SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1 mM [U-100% 15N] RsmE, 1 mM SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O' 2 '100% D2O' '1 mM [U-100% 13C; U-100% 15N] RsmE, 1 mM SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' '1 mM [U-100% 13C; U-100% 15N] RsmE, 1 mM SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O' 4 '100% D2O' ;1 mM [U-100% 15N] RsmE, 1 mM [U-100% 13C; U-100% 15N]-Ade/Ura RNA SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O ; 5 '95% H2O/5% D2O' ;1 mM [U-100% 15N] RsmE, 1 mM [U-100% 13C; U-100% 15N]-Ade/Ura RNA SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O ; 6 '100% D2O' ;1 mM [U-100% 15N] RsmE, 1 mM [U-100% 13C; U-100% 15N]-Cyt/Gua RNA SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O ; 7 '95% H2O/5% D2O' ;1 mM [U-100% 15N] RsmE, 1 mM [U-100% 13C; U-100% 15N]-Cyt/Gua RNA SL2(RsmZ), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O ; 8 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' 700 Bruker Avance 3 'Bruker Avance' 900 Bruker Avance 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MFE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 999 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MFE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 13.7 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.42 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MFE _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' processing TOPSPIN ? 1 Goddard 'chemical shift assignment' SPARKY ? 2 Goddard 'data analysis' SPARKY ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement AMBER ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MFE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MFE _struct.title 'Csr/Rsm protein-RNA recognition - A molecular affinity ruler: RsmZ(SL2)/RsmE(dimer) 2:1 complex' _struct.pdbx_descriptor 'Carbon storage regulator homolog' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MFE _struct_keywords.pdbx_keywords TRANSLATION/RNA _struct_keywords.text ;CsrA, RsmA, RsmE, RsmZ, CsrB, translation repressor protein, translation activation, protein sequestration, bacterial protein, non-coding RNA, sRNA, Pseudomonas aeruginosa, RNA-Binding Proteins, messenger RNA, modulation of binding affinity, molecular mimicry, TRANSLATION-RNA complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 45 ? GLN A 52 ? GLU A 45 GLN A 52 1 ? 8 HELX_P HELX_P2 2 GLU C 45 ? GLN C 52 ? GLU C 45 GLN C 52 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order hydrog1 hydrog ? ? B G 1 N1 ? ? ? 1_555 B C 22 N3 ? ? B G 17 B C 38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog2 hydrog ? ? B G 1 N2 ? ? ? 1_555 B C 22 O2 ? ? B G 17 B C 38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog3 hydrog ? ? B G 1 O6 ? ? ? 1_555 B C 22 N4 ? ? B G 17 B C 38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog4 hydrog ? ? B G 2 N1 ? ? ? 1_555 B C 21 N3 ? ? B G 18 B C 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog5 hydrog ? ? B G 2 N2 ? ? ? 1_555 B C 21 O2 ? ? B G 18 B C 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog6 hydrog ? ? B G 2 O6 ? ? ? 1_555 B C 21 N4 ? ? B G 18 B C 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog7 hydrog ? ? B G 3 N1 ? ? ? 1_555 B U 20 O2 ? ? B G 19 B U 36 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? hydrog8 hydrog ? ? B G 3 O6 ? ? ? 1_555 B U 20 N3 ? ? B G 19 B U 36 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? hydrog9 hydrog ? ? B C 4 N3 ? ? ? 1_555 B G 19 N1 ? ? B C 20 B G 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog10 hydrog ? ? B C 4 N4 ? ? ? 1_555 B G 19 O6 ? ? B C 20 B G 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog11 hydrog ? ? B C 4 O2 ? ? ? 1_555 B G 19 N2 ? ? B C 20 B G 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog12 hydrog ? ? B C 5 N3 ? ? ? 1_555 B G 18 N1 ? ? B C 21 B G 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog13 hydrog ? ? B C 5 N4 ? ? ? 1_555 B G 18 O6 ? ? B C 21 B G 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog14 hydrog ? ? B C 5 O2 ? ? ? 1_555 B G 18 N2 ? ? B C 21 B G 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog15 hydrog ? ? B A 6 N1 ? ? ? 1_555 B U 17 N3 ? ? B A 22 B U 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog16 hydrog ? ? B A 6 N6 ? ? ? 1_555 B U 17 O4 ? ? B A 22 B U 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog17 hydrog ? ? B U 7 N3 ? ? ? 1_555 B A 16 N1 ? ? B U 23 B A 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog18 hydrog ? ? B U 7 O4 ? ? ? 1_555 B A 16 N6 ? ? B U 23 B A 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog19 hydrog ? ? B C 8 N3 ? ? ? 1_555 B G 15 N1 ? ? B C 24 B G 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog20 hydrog ? ? B C 8 N4 ? ? ? 1_555 B G 15 O6 ? ? B C 24 B G 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog21 hydrog ? ? B C 8 O2 ? ? ? 1_555 B G 15 N2 ? ? B C 24 B G 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog22 hydrog ? ? D G 1 N1 ? ? ? 1_555 D C 22 N3 ? ? D G 17 D C 38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog23 hydrog ? ? D G 1 N2 ? ? ? 1_555 D C 22 O2 ? ? D G 17 D C 38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog24 hydrog ? ? D G 1 O6 ? ? ? 1_555 D C 22 N4 ? ? D G 17 D C 38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog25 hydrog ? ? D G 2 N1 ? ? ? 1_555 D C 21 N3 ? ? D G 18 D C 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog26 hydrog ? ? D G 2 N2 ? ? ? 1_555 D C 21 O2 ? ? D G 18 D C 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog27 hydrog ? ? D G 2 O6 ? ? ? 1_555 D C 21 N4 ? ? D G 18 D C 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog28 hydrog ? ? D G 3 N1 ? ? ? 1_555 D U 20 O2 ? ? D G 19 D U 36 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? hydrog29 hydrog ? ? D G 3 O6 ? ? ? 1_555 D U 20 N3 ? ? D G 19 D U 36 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? hydrog30 hydrog ? ? D C 4 N3 ? ? ? 1_555 D G 19 N1 ? ? D C 20 D G 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog31 hydrog ? ? D C 4 N4 ? ? ? 1_555 D G 19 O6 ? ? D C 20 D G 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog32 hydrog ? ? D C 4 O2 ? ? ? 1_555 D G 19 N2 ? ? D C 20 D G 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog33 hydrog ? ? D C 5 N3 ? ? ? 1_555 D G 18 N1 ? ? D C 21 D G 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog34 hydrog ? ? D C 5 N4 ? ? ? 1_555 D G 18 O6 ? ? D C 21 D G 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog35 hydrog ? ? D C 5 O2 ? ? ? 1_555 D G 18 N2 ? ? D C 21 D G 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog36 hydrog ? ? D A 6 N1 ? ? ? 1_555 D U 17 N3 ? ? D A 22 D U 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog37 hydrog ? ? D A 6 N6 ? ? ? 1_555 D U 17 O4 ? ? D A 22 D U 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog38 hydrog ? ? D U 7 N3 ? ? ? 1_555 D A 16 N1 ? ? D U 23 D A 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog39 hydrog ? ? D U 7 O4 ? ? ? 1_555 D A 16 N6 ? ? D U 23 D A 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog40 hydrog ? ? D C 8 N3 ? ? ? 1_555 D G 15 N1 ? ? D C 24 D G 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog41 hydrog ? ? D C 8 N4 ? ? ? 1_555 D G 15 O6 ? ? D C 24 D G 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog42 hydrog ? ? D C 8 O2 ? ? ? 1_555 D G 15 N2 ? ? D C 24 D G 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 2 ? LYS A 7 ? LEU A 2 LYS A 7 A 2 GLN C 29 ? ASN C 35 ? GLN C 29 ASN C 35 A 3 ILE C 18 ? SER C 26 ? ILE C 18 SER C 26 A 4 SER C 11 ? ILE C 14 ? SER C 11 ILE C 14 A 5 VAL A 42 ? ARG A 44 ? VAL A 42 ARG A 44 B 1 LEU C 2 ? LYS C 7 ? LEU C 2 LYS C 7 B 2 GLN A 29 ? ASN A 35 ? GLN A 29 ASN A 35 B 3 ILE A 18 ? SER A 26 ? ILE A 18 SER A 26 B 4 SER A 11 ? ILE A 14 ? SER A 11 ILE A 14 B 5 VAL C 42 ? ARG C 44 ? VAL C 42 ARG C 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 6 ? N ARG A 6 O VAL C 30 ? O VAL C 30 A 2 3 O ASN C 35 ? O ASN C 35 N THR C 19 ? N THR C 19 A 3 4 O ILE C 20 ? O ILE C 20 N ILE C 12 ? N ILE C 12 A 4 5 O ASN C 13 ? O ASN C 13 N HIS A 43 ? N HIS A 43 B 1 2 O LEU C 2 ? O LEU C 2 N ILE A 34 ? N ILE A 34 B 2 3 O ASN A 35 ? O ASN A 35 N THR A 19 ? N THR A 19 B 3 4 O ILE A 20 ? O ILE A 20 N ILE A 12 ? N ILE A 12 B 4 5 N ASN A 13 ? N ASN A 13 O HIS C 43 ? O HIS C 43 # _atom_sites.entry_id 2MFE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 ARG 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 THR 63 63 ? ? ? A . n A 1 64 PRO 64 64 ? ? ? A . n A 1 65 HIS 65 65 ? ? ? A . n A 1 66 HIS 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n A 1 68 HIS 68 68 ? ? ? A . n A 1 69 HIS 69 69 ? ? ? A . n A 1 70 HIS 70 70 ? ? ? A . n B 2 1 G 1 17 17 G G B . n B 2 2 G 2 18 18 G G B . n B 2 3 G 3 19 19 G G B . n B 2 4 C 4 20 20 C C B . n B 2 5 C 5 21 21 C C B . n B 2 6 A 6 22 22 A A B . n B 2 7 U 7 23 23 U U B . n B 2 8 C 8 24 24 C C B . n B 2 9 A 9 25 25 A A B . n B 2 10 A 10 26 26 A A B . n B 2 11 G 11 27 27 G G B . n B 2 12 G 12 28 28 G G B . n B 2 13 A 13 29 29 A A B . n B 2 14 C 14 30 30 C C B . n B 2 15 G 15 31 31 G G B . n B 2 16 A 16 32 32 A A B . n B 2 17 U 17 33 33 U U B . n B 2 18 G 18 34 34 G G B . n B 2 19 G 19 35 35 G G B . n B 2 20 U 20 36 36 U U B . n B 2 21 C 21 37 37 C C B . n B 2 22 C 22 38 38 C C B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 LEU 2 2 2 LEU LEU C . n C 1 3 ILE 3 3 3 ILE ILE C . n C 1 4 LEU 4 4 4 LEU LEU C . n C 1 5 THR 5 5 5 THR THR C . n C 1 6 ARG 6 6 6 ARG ARG C . n C 1 7 LYS 7 7 7 LYS LYS C . n C 1 8 VAL 8 8 8 VAL VAL C . n C 1 9 GLY 9 9 9 GLY GLY C . n C 1 10 GLU 10 10 10 GLU GLU C . n C 1 11 SER 11 11 11 SER SER C . n C 1 12 ILE 12 12 12 ILE ILE C . n C 1 13 ASN 13 13 13 ASN ASN C . n C 1 14 ILE 14 14 14 ILE ILE C . n C 1 15 GLY 15 15 15 GLY GLY C . n C 1 16 ASP 16 16 16 ASP ASP C . n C 1 17 ASP 17 17 17 ASP ASP C . n C 1 18 ILE 18 18 18 ILE ILE C . n C 1 19 THR 19 19 19 THR THR C . n C 1 20 ILE 20 20 20 ILE ILE C . n C 1 21 THR 21 21 21 THR THR C . n C 1 22 ILE 22 22 22 ILE ILE C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 GLY 24 24 24 GLY GLY C . n C 1 25 VAL 25 25 25 VAL VAL C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 GLY 27 27 27 GLY GLY C . n C 1 28 GLN 28 28 28 GLN GLN C . n C 1 29 GLN 29 29 29 GLN GLN C . n C 1 30 VAL 30 30 30 VAL VAL C . n C 1 31 ARG 31 31 31 ARG ARG C . n C 1 32 ILE 32 32 32 ILE ILE C . n C 1 33 GLY 33 33 33 GLY GLY C . n C 1 34 ILE 34 34 34 ILE ILE C . n C 1 35 ASN 35 35 35 ASN ASN C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 PRO 37 37 37 PRO PRO C . n C 1 38 LYS 38 38 38 LYS LYS C . n C 1 39 ASP 39 39 39 ASP ASP C . n C 1 40 VAL 40 40 40 VAL VAL C . n C 1 41 ALA 41 41 41 ALA ALA C . n C 1 42 VAL 42 42 42 VAL VAL C . n C 1 43 HIS 43 43 43 HIS HIS C . n C 1 44 ARG 44 44 44 ARG ARG C . n C 1 45 GLU 45 45 45 GLU GLU C . n C 1 46 GLU 46 46 46 GLU GLU C . n C 1 47 ILE 47 47 47 ILE ILE C . n C 1 48 TYR 48 48 48 TYR TYR C . n C 1 49 GLN 49 49 49 GLN GLN C . n C 1 50 ARG 50 50 50 ARG ARG C . n C 1 51 ILE 51 51 51 ILE ILE C . n C 1 52 GLN 52 52 52 GLN GLN C . n C 1 53 ALA 53 53 53 ALA ALA C . n C 1 54 GLY 54 54 54 GLY GLY C . n C 1 55 LEU 55 55 55 LEU LEU C . n C 1 56 THR 56 56 56 THR THR C . n C 1 57 ALA 57 57 57 ALA ALA C . n C 1 58 PRO 58 58 58 PRO PRO C . n C 1 59 ASP 59 59 59 ASP ASP C . n C 1 60 LYS 60 60 ? ? ? C . n C 1 61 ARG 61 61 ? ? ? C . n C 1 62 GLU 62 62 ? ? ? C . n C 1 63 THR 63 63 ? ? ? C . n C 1 64 PRO 64 64 ? ? ? C . n C 1 65 HIS 65 65 ? ? ? C . n C 1 66 HIS 66 66 ? ? ? C . n C 1 67 HIS 67 67 ? ? ? C . n C 1 68 HIS 68 68 ? ? ? C . n C 1 69 HIS 69 69 ? ? ? C . n C 1 70 HIS 70 70 ? ? ? C . n D 2 1 G 1 17 17 G G D . n D 2 2 G 2 18 18 G G D . n D 2 3 G 3 19 19 G G D . n D 2 4 C 4 20 20 C C D . n D 2 5 C 5 21 21 C C D . n D 2 6 A 6 22 22 A A D . n D 2 7 U 7 23 23 U U D . n D 2 8 C 8 24 24 C C D . n D 2 9 A 9 25 25 A A D . n D 2 10 A 10 26 26 A A D . n D 2 11 G 11 27 27 G G D . n D 2 12 G 12 28 28 G G D . n D 2 13 A 13 29 29 A A D . n D 2 14 C 14 30 30 C C D . n D 2 15 G 15 31 31 G G D . n D 2 16 A 16 32 32 A A D . n D 2 17 U 17 33 33 U U D . n D 2 18 G 18 34 34 G G D . n D 2 19 G 19 35 35 G G D . n D 2 20 U 20 36 36 U U D . n D 2 21 C 21 37 37 C C D . n D 2 22 C 22 38 38 C C D . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8330 ? 1 MORE -42 ? 1 'SSA (A^2)' 11790 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-02-26 2 'Structure model' 1 1 2014-03-26 3 'Structure model' 1 2 2014-05-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RsmE-1 1 ? mM '[U-100% 15N]' 1 'SL2(RsmZ)-2' 1 ? mM ? 1 'potassium phosphate-3' 0.05 ? mM ? 1 'sodium chloride-4' 0.03 ? mM ? 1 RsmE-5 1 ? mM '[U-100% 15N]' 2 'SL2(RsmZ)-6' 1 ? mM ? 2 'potassium phosphate-7' 0.05 ? mM ? 2 'sodium chloride-8' 0.03 ? mM ? 2 RsmE-9 1 ? mM '[U-100% 13C; U-100% 15N]' 3 'SL2(RsmZ)-10' 1 ? mM ? 3 'potassium phosphate-11' 0.05 ? mM ? 3 'sodium chloride-12' 0.03 ? mM ? 3 RsmE-13 1 ? mM '[U-100% 13C; U-100% 15N]' 4 'SL2(RsmZ)-14' 1 ? mM ? 4 'potassium phosphate-15' 0.05 ? mM ? 4 'sodium chloride-16' 0.03 ? mM ? 4 RsmE-17 1 ? mM '[U-100% 15N]' 5 'SL2(RsmZ)-18' 1 ? mM '[U-100% 13C; U-100% 15N]-Ade/Ura RNA' 5 'potassium phosphate-19' 0.05 ? mM ? 5 'sodium chloride-20' 0.03 ? mM ? 5 RsmE-21 1 ? mM '[U-100% 15N]' 6 'SL2(RsmZ)-22' 1 ? mM '[U-100% 13C; U-100% 15N]-Ade/Ura RNA' 6 'potassium phosphate-23' 0.05 ? mM ? 6 'sodium chloride-24' 0.03 ? mM ? 6 RsmE-25 1 ? mM '[U-100% 15N]' 7 'SL2(RsmZ)-26' 1 ? mM '[U-100% 13C; U-100% 15N]-Cyt/Gua RNA' 7 'potassium phosphate-27' 0.05 ? mM ? 7 'sodium chloride-28' 0.03 ? mM ? 7 RsmE-29 1 ? mM '[U-100% 15N]' 8 'SL2(RsmZ)-30' 1 ? mM '[U-100% 13C; U-100% 15N]-Cyt/Gua RNA' 8 'potassium phosphate-31' 0.05 ? mM ? 8 'sodium chloride-32' 0.03 ? mM ? 8 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MFE _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count 12 _pdbx_nmr_constraints.NOE_constraints_total 2700 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 "O4'" D G 28 ? ? "C1'" D G 28 ? ? N9 D G 28 ? ? 113.05 108.50 4.55 0.70 N 2 10 "O4'" B G 28 ? ? "C1'" B G 28 ? ? N9 B G 28 ? ? 112.79 108.50 4.29 0.70 N 3 12 "O4'" B G 28 ? ? "C1'" B G 28 ? ? N9 B G 28 ? ? 112.72 108.50 4.22 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 17 ? ? -144.42 11.97 2 1 SER A 26 ? ? -150.58 57.19 3 1 PRO A 58 ? ? -63.83 1.69 4 1 ASP C 17 ? ? -142.09 12.20 5 2 ASP A 17 ? ? -145.87 14.06 6 2 SER A 26 ? ? -144.60 57.42 7 2 ASP C 17 ? ? -141.96 13.90 8 2 SER C 26 ? ? -150.63 60.93 9 2 PRO C 58 ? ? -68.62 -176.94 10 3 ASP A 17 ? ? -141.63 13.70 11 3 SER A 26 ? ? -148.66 57.32 12 3 PRO C 58 ? ? -70.05 -169.35 13 4 ASP A 17 ? ? -143.37 10.98 14 4 ASP C 17 ? ? -145.93 14.11 15 4 SER C 26 ? ? -148.29 55.39 16 5 ASP A 17 ? ? -146.50 13.15 17 5 GLU A 46 ? ? -69.63 3.94 18 5 SER C 26 ? ? -151.02 60.83 19 5 PRO C 58 ? ? -68.49 -176.84 20 6 PRO C 58 ? ? -73.26 -168.50 21 7 ASP A 17 ? ? 119.20 31.04 22 7 PRO A 58 ? ? -69.75 -174.41 23 7 ASP C 17 ? ? -147.32 11.55 24 7 SER C 26 ? ? -150.99 58.75 25 8 GLU A 46 ? ? -69.81 1.49 26 8 ILE A 47 ? ? -134.39 -30.09 27 8 ASP C 17 ? ? -142.46 13.57 28 8 SER C 26 ? ? -150.93 60.13 29 9 ASP A 17 ? ? -146.58 13.08 30 9 SER A 26 ? ? -147.69 58.32 31 9 PRO A 58 ? ? -69.80 -175.97 32 9 ASP C 17 ? ? -143.34 12.28 33 9 SER C 26 ? ? -151.20 60.83 34 9 LYS C 38 ? ? -69.89 0.24 35 10 ASP A 17 ? ? -143.50 13.53 36 10 ASP C 17 ? ? -143.64 12.02 37 10 SER C 26 ? ? -154.51 60.17 38 11 ASP A 17 ? ? -144.72 13.33 39 11 SER A 26 ? ? -150.82 48.14 40 11 ASP C 17 ? ? -141.19 13.05 41 11 SER C 26 ? ? -147.16 54.24 42 11 PRO C 58 ? ? -70.95 -168.14 43 12 ASP C 17 ? ? -144.70 12.49 44 13 ASP A 17 ? ? -148.23 14.00 45 13 PRO A 58 ? ? -66.86 -174.83 46 13 ASP C 17 ? ? -144.86 14.21 47 13 SER C 26 ? ? -150.75 45.03 48 13 PRO C 58 ? ? -73.55 -164.25 49 14 ASP A 17 ? ? -144.35 13.15 50 14 PRO A 58 ? ? -76.02 -169.06 51 14 ASP C 17 ? ? -144.56 12.90 52 14 LYS C 38 ? ? -69.08 0.31 53 15 SER A 26 ? ? -148.17 53.71 54 15 ASP C 17 ? ? -141.05 11.53 55 15 SER C 26 ? ? -150.71 56.49 56 15 PRO C 58 ? ? -66.85 -176.16 57 16 ASP A 17 ? ? -145.41 11.78 58 16 SER C 26 ? ? -148.83 54.33 59 17 ASP A 17 ? ? -143.00 11.53 60 17 SER C 26 ? ? -148.42 53.01 61 18 ASP A 17 ? ? -143.98 11.76 62 18 ASP C 17 ? ? -145.79 10.31 63 18 SER C 26 ? ? -148.74 55.18 64 18 PRO C 58 ? ? -67.54 -176.98 65 19 ASP A 17 ? ? -141.99 10.58 66 19 SER A 26 ? ? -150.01 60.14 67 20 ASP A 17 ? ? -144.23 14.12 68 20 SER A 26 ? ? -142.64 58.67 69 20 ASP C 17 ? ? 117.62 31.94 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 A B 29 ? ? 0.077 'SIDE CHAIN' 2 1 G D 27 ? ? 0.110 'SIDE CHAIN' 3 1 A D 29 ? ? 0.062 'SIDE CHAIN' 4 1 G D 31 ? ? 0.063 'SIDE CHAIN' 5 2 G B 27 ? ? 0.080 'SIDE CHAIN' 6 2 A B 29 ? ? 0.079 'SIDE CHAIN' 7 2 G D 27 ? ? 0.067 'SIDE CHAIN' 8 3 G B 27 ? ? 0.106 'SIDE CHAIN' 9 3 A B 29 ? ? 0.065 'SIDE CHAIN' 10 3 G D 27 ? ? 0.060 'SIDE CHAIN' 11 3 A D 29 ? ? 0.063 'SIDE CHAIN' 12 4 G B 27 ? ? 0.111 'SIDE CHAIN' 13 4 A B 29 ? ? 0.065 'SIDE CHAIN' 14 4 A D 29 ? ? 0.074 'SIDE CHAIN' 15 5 G B 27 ? ? 0.084 'SIDE CHAIN' 16 5 A B 29 ? ? 0.062 'SIDE CHAIN' 17 5 G B 31 ? ? 0.065 'SIDE CHAIN' 18 5 A D 29 ? ? 0.064 'SIDE CHAIN' 19 6 G B 27 ? ? 0.086 'SIDE CHAIN' 20 6 A B 29 ? ? 0.062 'SIDE CHAIN' 21 6 A D 29 ? ? 0.061 'SIDE CHAIN' 22 7 G B 27 ? ? 0.109 'SIDE CHAIN' 23 7 A B 29 ? ? 0.080 'SIDE CHAIN' 24 7 G B 31 ? ? 0.057 'SIDE CHAIN' 25 7 G D 27 ? ? 0.089 'SIDE CHAIN' 26 7 A D 29 ? ? 0.085 'SIDE CHAIN' 27 8 G B 27 ? ? 0.114 'SIDE CHAIN' 28 8 A B 29 ? ? 0.073 'SIDE CHAIN' 29 8 A D 29 ? ? 0.073 'SIDE CHAIN' 30 9 A B 29 ? ? 0.092 'SIDE CHAIN' 31 9 G D 27 ? ? 0.123 'SIDE CHAIN' 32 9 A D 29 ? ? 0.079 'SIDE CHAIN' 33 10 G B 27 ? ? 0.089 'SIDE CHAIN' 34 10 A B 29 ? ? 0.096 'SIDE CHAIN' 35 10 A D 29 ? ? 0.066 'SIDE CHAIN' 36 11 G B 27 ? ? 0.104 'SIDE CHAIN' 37 11 A B 29 ? ? 0.089 'SIDE CHAIN' 38 11 G D 27 ? ? 0.098 'SIDE CHAIN' 39 11 A D 29 ? ? 0.067 'SIDE CHAIN' 40 12 G B 27 ? ? 0.124 'SIDE CHAIN' 41 12 A B 29 ? ? 0.065 'SIDE CHAIN' 42 12 G D 27 ? ? 0.076 'SIDE CHAIN' 43 12 A D 29 ? ? 0.079 'SIDE CHAIN' 44 13 G B 27 ? ? 0.124 'SIDE CHAIN' 45 13 A B 29 ? ? 0.069 'SIDE CHAIN' 46 13 G D 27 ? ? 0.115 'SIDE CHAIN' 47 13 A D 29 ? ? 0.067 'SIDE CHAIN' 48 14 G B 27 ? ? 0.099 'SIDE CHAIN' 49 14 A B 29 ? ? 0.084 'SIDE CHAIN' 50 14 G D 27 ? ? 0.108 'SIDE CHAIN' 51 14 A D 29 ? ? 0.068 'SIDE CHAIN' 52 15 G B 27 ? ? 0.104 'SIDE CHAIN' 53 15 A B 29 ? ? 0.081 'SIDE CHAIN' 54 15 G D 27 ? ? 0.121 'SIDE CHAIN' 55 15 A D 29 ? ? 0.072 'SIDE CHAIN' 56 16 G B 27 ? ? 0.093 'SIDE CHAIN' 57 16 A B 29 ? ? 0.067 'SIDE CHAIN' 58 16 G D 27 ? ? 0.121 'SIDE CHAIN' 59 16 A D 29 ? ? 0.064 'SIDE CHAIN' 60 16 G D 31 ? ? 0.059 'SIDE CHAIN' 61 17 G B 27 ? ? 0.111 'SIDE CHAIN' 62 17 A B 29 ? ? 0.067 'SIDE CHAIN' 63 17 G D 27 ? ? 0.099 'SIDE CHAIN' 64 18 G B 27 ? ? 0.108 'SIDE CHAIN' 65 18 A B 29 ? ? 0.084 'SIDE CHAIN' 66 18 G D 27 ? ? 0.085 'SIDE CHAIN' 67 18 A D 29 ? ? 0.082 'SIDE CHAIN' 68 19 G B 27 ? ? 0.101 'SIDE CHAIN' 69 19 A B 29 ? ? 0.087 'SIDE CHAIN' 70 19 G D 27 ? ? 0.063 'SIDE CHAIN' 71 19 A D 29 ? ? 0.099 'SIDE CHAIN' 72 20 G B 27 ? ? 0.082 'SIDE CHAIN' 73 20 A B 29 ? ? 0.058 'SIDE CHAIN' 74 20 G D 27 ? ? 0.128 'SIDE CHAIN' 75 20 A D 29 ? ? 0.063 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 60 ? A LYS 60 2 1 Y 1 A ARG 61 ? A ARG 61 3 1 Y 1 A GLU 62 ? A GLU 62 4 1 Y 1 A THR 63 ? A THR 63 5 1 Y 1 A PRO 64 ? A PRO 64 6 1 Y 1 A HIS 65 ? A HIS 65 7 1 Y 1 A HIS 66 ? A HIS 66 8 1 Y 1 A HIS 67 ? A HIS 67 9 1 Y 1 A HIS 68 ? A HIS 68 10 1 Y 1 A HIS 69 ? A HIS 69 11 1 Y 1 A HIS 70 ? A HIS 70 12 1 Y 1 C LYS 60 ? C LYS 60 13 1 Y 1 C ARG 61 ? C ARG 61 14 1 Y 1 C GLU 62 ? C GLU 62 15 1 Y 1 C THR 63 ? C THR 63 16 1 Y 1 C PRO 64 ? C PRO 64 17 1 Y 1 C HIS 65 ? C HIS 65 18 1 Y 1 C HIS 66 ? C HIS 66 19 1 Y 1 C HIS 67 ? C HIS 67 20 1 Y 1 C HIS 68 ? C HIS 68 21 1 Y 1 C HIS 69 ? C HIS 69 22 1 Y 1 C HIS 70 ? C HIS 70 23 2 Y 1 A LYS 60 ? A LYS 60 24 2 Y 1 A ARG 61 ? A ARG 61 25 2 Y 1 A GLU 62 ? A GLU 62 26 2 Y 1 A THR 63 ? A THR 63 27 2 Y 1 A PRO 64 ? A PRO 64 28 2 Y 1 A HIS 65 ? A HIS 65 29 2 Y 1 A HIS 66 ? A HIS 66 30 2 Y 1 A HIS 67 ? A HIS 67 31 2 Y 1 A HIS 68 ? A HIS 68 32 2 Y 1 A HIS 69 ? A HIS 69 33 2 Y 1 A HIS 70 ? A HIS 70 34 2 Y 1 C LYS 60 ? C LYS 60 35 2 Y 1 C ARG 61 ? C ARG 61 36 2 Y 1 C GLU 62 ? C GLU 62 37 2 Y 1 C THR 63 ? C THR 63 38 2 Y 1 C PRO 64 ? C PRO 64 39 2 Y 1 C HIS 65 ? C HIS 65 40 2 Y 1 C HIS 66 ? C HIS 66 41 2 Y 1 C HIS 67 ? C HIS 67 42 2 Y 1 C HIS 68 ? C HIS 68 43 2 Y 1 C HIS 69 ? C HIS 69 44 2 Y 1 C HIS 70 ? C HIS 70 45 3 Y 1 A LYS 60 ? A LYS 60 46 3 Y 1 A ARG 61 ? A ARG 61 47 3 Y 1 A GLU 62 ? A GLU 62 48 3 Y 1 A THR 63 ? A THR 63 49 3 Y 1 A PRO 64 ? A PRO 64 50 3 Y 1 A HIS 65 ? A HIS 65 51 3 Y 1 A HIS 66 ? A HIS 66 52 3 Y 1 A HIS 67 ? A HIS 67 53 3 Y 1 A HIS 68 ? A HIS 68 54 3 Y 1 A HIS 69 ? A HIS 69 55 3 Y 1 A HIS 70 ? A HIS 70 56 3 Y 1 C LYS 60 ? C LYS 60 57 3 Y 1 C ARG 61 ? C ARG 61 58 3 Y 1 C GLU 62 ? C GLU 62 59 3 Y 1 C THR 63 ? C THR 63 60 3 Y 1 C PRO 64 ? C PRO 64 61 3 Y 1 C HIS 65 ? C HIS 65 62 3 Y 1 C HIS 66 ? C HIS 66 63 3 Y 1 C HIS 67 ? C HIS 67 64 3 Y 1 C HIS 68 ? C HIS 68 65 3 Y 1 C HIS 69 ? C HIS 69 66 3 Y 1 C HIS 70 ? C HIS 70 67 4 Y 1 A LYS 60 ? A LYS 60 68 4 Y 1 A ARG 61 ? A ARG 61 69 4 Y 1 A GLU 62 ? A GLU 62 70 4 Y 1 A THR 63 ? A THR 63 71 4 Y 1 A PRO 64 ? A PRO 64 72 4 Y 1 A HIS 65 ? A HIS 65 73 4 Y 1 A HIS 66 ? A HIS 66 74 4 Y 1 A HIS 67 ? A HIS 67 75 4 Y 1 A HIS 68 ? A HIS 68 76 4 Y 1 A HIS 69 ? A HIS 69 77 4 Y 1 A HIS 70 ? A HIS 70 78 4 Y 1 C LYS 60 ? C LYS 60 79 4 Y 1 C ARG 61 ? C ARG 61 80 4 Y 1 C GLU 62 ? C GLU 62 81 4 Y 1 C THR 63 ? C THR 63 82 4 Y 1 C PRO 64 ? C PRO 64 83 4 Y 1 C HIS 65 ? C HIS 65 84 4 Y 1 C HIS 66 ? C HIS 66 85 4 Y 1 C HIS 67 ? C HIS 67 86 4 Y 1 C HIS 68 ? C HIS 68 87 4 Y 1 C HIS 69 ? C HIS 69 88 4 Y 1 C HIS 70 ? C HIS 70 89 5 Y 1 A LYS 60 ? A LYS 60 90 5 Y 1 A ARG 61 ? A ARG 61 91 5 Y 1 A GLU 62 ? A GLU 62 92 5 Y 1 A THR 63 ? A THR 63 93 5 Y 1 A PRO 64 ? A PRO 64 94 5 Y 1 A HIS 65 ? A HIS 65 95 5 Y 1 A HIS 66 ? A HIS 66 96 5 Y 1 A HIS 67 ? A HIS 67 97 5 Y 1 A HIS 68 ? A HIS 68 98 5 Y 1 A HIS 69 ? A HIS 69 99 5 Y 1 A HIS 70 ? A HIS 70 100 5 Y 1 C LYS 60 ? C LYS 60 101 5 Y 1 C ARG 61 ? C ARG 61 102 5 Y 1 C GLU 62 ? C GLU 62 103 5 Y 1 C THR 63 ? C THR 63 104 5 Y 1 C PRO 64 ? C PRO 64 105 5 Y 1 C HIS 65 ? C HIS 65 106 5 Y 1 C HIS 66 ? C HIS 66 107 5 Y 1 C HIS 67 ? C HIS 67 108 5 Y 1 C HIS 68 ? C HIS 68 109 5 Y 1 C HIS 69 ? C HIS 69 110 5 Y 1 C HIS 70 ? C HIS 70 111 6 Y 1 A LYS 60 ? A LYS 60 112 6 Y 1 A ARG 61 ? A ARG 61 113 6 Y 1 A GLU 62 ? A GLU 62 114 6 Y 1 A THR 63 ? A THR 63 115 6 Y 1 A PRO 64 ? A PRO 64 116 6 Y 1 A HIS 65 ? A HIS 65 117 6 Y 1 A HIS 66 ? A HIS 66 118 6 Y 1 A HIS 67 ? A HIS 67 119 6 Y 1 A HIS 68 ? A HIS 68 120 6 Y 1 A HIS 69 ? A HIS 69 121 6 Y 1 A HIS 70 ? A HIS 70 122 6 Y 1 C LYS 60 ? C LYS 60 123 6 Y 1 C ARG 61 ? C ARG 61 124 6 Y 1 C GLU 62 ? C GLU 62 125 6 Y 1 C THR 63 ? C THR 63 126 6 Y 1 C PRO 64 ? C PRO 64 127 6 Y 1 C HIS 65 ? C HIS 65 128 6 Y 1 C HIS 66 ? C HIS 66 129 6 Y 1 C HIS 67 ? C HIS 67 130 6 Y 1 C HIS 68 ? C HIS 68 131 6 Y 1 C HIS 69 ? C HIS 69 132 6 Y 1 C HIS 70 ? C HIS 70 133 7 Y 1 A LYS 60 ? A LYS 60 134 7 Y 1 A ARG 61 ? A ARG 61 135 7 Y 1 A GLU 62 ? A GLU 62 136 7 Y 1 A THR 63 ? A THR 63 137 7 Y 1 A PRO 64 ? A PRO 64 138 7 Y 1 A HIS 65 ? A HIS 65 139 7 Y 1 A HIS 66 ? A HIS 66 140 7 Y 1 A HIS 67 ? A HIS 67 141 7 Y 1 A HIS 68 ? A HIS 68 142 7 Y 1 A HIS 69 ? A HIS 69 143 7 Y 1 A HIS 70 ? A HIS 70 144 7 Y 1 C LYS 60 ? C LYS 60 145 7 Y 1 C ARG 61 ? C ARG 61 146 7 Y 1 C GLU 62 ? C GLU 62 147 7 Y 1 C THR 63 ? C THR 63 148 7 Y 1 C PRO 64 ? C PRO 64 149 7 Y 1 C HIS 65 ? C HIS 65 150 7 Y 1 C HIS 66 ? C HIS 66 151 7 Y 1 C HIS 67 ? C HIS 67 152 7 Y 1 C HIS 68 ? C HIS 68 153 7 Y 1 C HIS 69 ? C HIS 69 154 7 Y 1 C HIS 70 ? C HIS 70 155 8 Y 1 A LYS 60 ? A LYS 60 156 8 Y 1 A ARG 61 ? A ARG 61 157 8 Y 1 A GLU 62 ? A GLU 62 158 8 Y 1 A THR 63 ? A THR 63 159 8 Y 1 A PRO 64 ? A PRO 64 160 8 Y 1 A HIS 65 ? A HIS 65 161 8 Y 1 A HIS 66 ? A HIS 66 162 8 Y 1 A HIS 67 ? A HIS 67 163 8 Y 1 A HIS 68 ? A HIS 68 164 8 Y 1 A HIS 69 ? A HIS 69 165 8 Y 1 A HIS 70 ? A HIS 70 166 8 Y 1 C LYS 60 ? C LYS 60 167 8 Y 1 C ARG 61 ? C ARG 61 168 8 Y 1 C GLU 62 ? C GLU 62 169 8 Y 1 C THR 63 ? C THR 63 170 8 Y 1 C PRO 64 ? C PRO 64 171 8 Y 1 C HIS 65 ? C HIS 65 172 8 Y 1 C HIS 66 ? C HIS 66 173 8 Y 1 C HIS 67 ? C HIS 67 174 8 Y 1 C HIS 68 ? C HIS 68 175 8 Y 1 C HIS 69 ? C HIS 69 176 8 Y 1 C HIS 70 ? C HIS 70 177 9 Y 1 A LYS 60 ? A LYS 60 178 9 Y 1 A ARG 61 ? A ARG 61 179 9 Y 1 A GLU 62 ? A GLU 62 180 9 Y 1 A THR 63 ? A THR 63 181 9 Y 1 A PRO 64 ? A PRO 64 182 9 Y 1 A HIS 65 ? A HIS 65 183 9 Y 1 A HIS 66 ? A HIS 66 184 9 Y 1 A HIS 67 ? A HIS 67 185 9 Y 1 A HIS 68 ? A HIS 68 186 9 Y 1 A HIS 69 ? A HIS 69 187 9 Y 1 A HIS 70 ? A HIS 70 188 9 Y 1 C LYS 60 ? C LYS 60 189 9 Y 1 C ARG 61 ? C ARG 61 190 9 Y 1 C GLU 62 ? C GLU 62 191 9 Y 1 C THR 63 ? C THR 63 192 9 Y 1 C PRO 64 ? C PRO 64 193 9 Y 1 C HIS 65 ? C HIS 65 194 9 Y 1 C HIS 66 ? C HIS 66 195 9 Y 1 C HIS 67 ? C HIS 67 196 9 Y 1 C HIS 68 ? C HIS 68 197 9 Y 1 C HIS 69 ? C HIS 69 198 9 Y 1 C HIS 70 ? C HIS 70 199 10 Y 1 A LYS 60 ? A LYS 60 200 10 Y 1 A ARG 61 ? A ARG 61 201 10 Y 1 A GLU 62 ? A GLU 62 202 10 Y 1 A THR 63 ? A THR 63 203 10 Y 1 A PRO 64 ? A PRO 64 204 10 Y 1 A HIS 65 ? A HIS 65 205 10 Y 1 A HIS 66 ? A HIS 66 206 10 Y 1 A HIS 67 ? A HIS 67 207 10 Y 1 A HIS 68 ? A HIS 68 208 10 Y 1 A HIS 69 ? A HIS 69 209 10 Y 1 A HIS 70 ? A HIS 70 210 10 Y 1 C LYS 60 ? C LYS 60 211 10 Y 1 C ARG 61 ? C ARG 61 212 10 Y 1 C GLU 62 ? C GLU 62 213 10 Y 1 C THR 63 ? C THR 63 214 10 Y 1 C PRO 64 ? C PRO 64 215 10 Y 1 C HIS 65 ? C HIS 65 216 10 Y 1 C HIS 66 ? C HIS 66 217 10 Y 1 C HIS 67 ? C HIS 67 218 10 Y 1 C HIS 68 ? C HIS 68 219 10 Y 1 C HIS 69 ? C HIS 69 220 10 Y 1 C HIS 70 ? C HIS 70 221 11 Y 1 A LYS 60 ? A LYS 60 222 11 Y 1 A ARG 61 ? A ARG 61 223 11 Y 1 A GLU 62 ? A GLU 62 224 11 Y 1 A THR 63 ? A THR 63 225 11 Y 1 A PRO 64 ? A PRO 64 226 11 Y 1 A HIS 65 ? A HIS 65 227 11 Y 1 A HIS 66 ? A HIS 66 228 11 Y 1 A HIS 67 ? A HIS 67 229 11 Y 1 A HIS 68 ? A HIS 68 230 11 Y 1 A HIS 69 ? A HIS 69 231 11 Y 1 A HIS 70 ? A HIS 70 232 11 Y 1 C LYS 60 ? C LYS 60 233 11 Y 1 C ARG 61 ? C ARG 61 234 11 Y 1 C GLU 62 ? C GLU 62 235 11 Y 1 C THR 63 ? C THR 63 236 11 Y 1 C PRO 64 ? C PRO 64 237 11 Y 1 C HIS 65 ? C HIS 65 238 11 Y 1 C HIS 66 ? C HIS 66 239 11 Y 1 C HIS 67 ? C HIS 67 240 11 Y 1 C HIS 68 ? C HIS 68 241 11 Y 1 C HIS 69 ? C HIS 69 242 11 Y 1 C HIS 70 ? C HIS 70 243 12 Y 1 A LYS 60 ? A LYS 60 244 12 Y 1 A ARG 61 ? A ARG 61 245 12 Y 1 A GLU 62 ? A GLU 62 246 12 Y 1 A THR 63 ? A THR 63 247 12 Y 1 A PRO 64 ? A PRO 64 248 12 Y 1 A HIS 65 ? A HIS 65 249 12 Y 1 A HIS 66 ? A HIS 66 250 12 Y 1 A HIS 67 ? A HIS 67 251 12 Y 1 A HIS 68 ? A HIS 68 252 12 Y 1 A HIS 69 ? A HIS 69 253 12 Y 1 A HIS 70 ? A HIS 70 254 12 Y 1 C LYS 60 ? C LYS 60 255 12 Y 1 C ARG 61 ? C ARG 61 256 12 Y 1 C GLU 62 ? C GLU 62 257 12 Y 1 C THR 63 ? C THR 63 258 12 Y 1 C PRO 64 ? C PRO 64 259 12 Y 1 C HIS 65 ? C HIS 65 260 12 Y 1 C HIS 66 ? C HIS 66 261 12 Y 1 C HIS 67 ? C HIS 67 262 12 Y 1 C HIS 68 ? C HIS 68 263 12 Y 1 C HIS 69 ? C HIS 69 264 12 Y 1 C HIS 70 ? C HIS 70 265 13 Y 1 A LYS 60 ? A LYS 60 266 13 Y 1 A ARG 61 ? A ARG 61 267 13 Y 1 A GLU 62 ? A GLU 62 268 13 Y 1 A THR 63 ? A THR 63 269 13 Y 1 A PRO 64 ? A PRO 64 270 13 Y 1 A HIS 65 ? A HIS 65 271 13 Y 1 A HIS 66 ? A HIS 66 272 13 Y 1 A HIS 67 ? A HIS 67 273 13 Y 1 A HIS 68 ? A HIS 68 274 13 Y 1 A HIS 69 ? A HIS 69 275 13 Y 1 A HIS 70 ? A HIS 70 276 13 Y 1 C LYS 60 ? C LYS 60 277 13 Y 1 C ARG 61 ? C ARG 61 278 13 Y 1 C GLU 62 ? C GLU 62 279 13 Y 1 C THR 63 ? C THR 63 280 13 Y 1 C PRO 64 ? C PRO 64 281 13 Y 1 C HIS 65 ? C HIS 65 282 13 Y 1 C HIS 66 ? C HIS 66 283 13 Y 1 C HIS 67 ? C HIS 67 284 13 Y 1 C HIS 68 ? C HIS 68 285 13 Y 1 C HIS 69 ? C HIS 69 286 13 Y 1 C HIS 70 ? C HIS 70 287 14 Y 1 A LYS 60 ? A LYS 60 288 14 Y 1 A ARG 61 ? A ARG 61 289 14 Y 1 A GLU 62 ? A GLU 62 290 14 Y 1 A THR 63 ? A THR 63 291 14 Y 1 A PRO 64 ? A PRO 64 292 14 Y 1 A HIS 65 ? A HIS 65 293 14 Y 1 A HIS 66 ? A HIS 66 294 14 Y 1 A HIS 67 ? A HIS 67 295 14 Y 1 A HIS 68 ? A HIS 68 296 14 Y 1 A HIS 69 ? A HIS 69 297 14 Y 1 A HIS 70 ? A HIS 70 298 14 Y 1 C LYS 60 ? C LYS 60 299 14 Y 1 C ARG 61 ? C ARG 61 300 14 Y 1 C GLU 62 ? C GLU 62 301 14 Y 1 C THR 63 ? C THR 63 302 14 Y 1 C PRO 64 ? C PRO 64 303 14 Y 1 C HIS 65 ? C HIS 65 304 14 Y 1 C HIS 66 ? C HIS 66 305 14 Y 1 C HIS 67 ? C HIS 67 306 14 Y 1 C HIS 68 ? C HIS 68 307 14 Y 1 C HIS 69 ? C HIS 69 308 14 Y 1 C HIS 70 ? C HIS 70 309 15 Y 1 A LYS 60 ? A LYS 60 310 15 Y 1 A ARG 61 ? A ARG 61 311 15 Y 1 A GLU 62 ? A GLU 62 312 15 Y 1 A THR 63 ? A THR 63 313 15 Y 1 A PRO 64 ? A PRO 64 314 15 Y 1 A HIS 65 ? A HIS 65 315 15 Y 1 A HIS 66 ? A HIS 66 316 15 Y 1 A HIS 67 ? A HIS 67 317 15 Y 1 A HIS 68 ? A HIS 68 318 15 Y 1 A HIS 69 ? A HIS 69 319 15 Y 1 A HIS 70 ? A HIS 70 320 15 Y 1 C LYS 60 ? C LYS 60 321 15 Y 1 C ARG 61 ? C ARG 61 322 15 Y 1 C GLU 62 ? C GLU 62 323 15 Y 1 C THR 63 ? C THR 63 324 15 Y 1 C PRO 64 ? C PRO 64 325 15 Y 1 C HIS 65 ? C HIS 65 326 15 Y 1 C HIS 66 ? C HIS 66 327 15 Y 1 C HIS 67 ? C HIS 67 328 15 Y 1 C HIS 68 ? C HIS 68 329 15 Y 1 C HIS 69 ? C HIS 69 330 15 Y 1 C HIS 70 ? C HIS 70 331 16 Y 1 A LYS 60 ? A LYS 60 332 16 Y 1 A ARG 61 ? A ARG 61 333 16 Y 1 A GLU 62 ? A GLU 62 334 16 Y 1 A THR 63 ? A THR 63 335 16 Y 1 A PRO 64 ? A PRO 64 336 16 Y 1 A HIS 65 ? A HIS 65 337 16 Y 1 A HIS 66 ? A HIS 66 338 16 Y 1 A HIS 67 ? A HIS 67 339 16 Y 1 A HIS 68 ? A HIS 68 340 16 Y 1 A HIS 69 ? A HIS 69 341 16 Y 1 A HIS 70 ? A HIS 70 342 16 Y 1 C LYS 60 ? C LYS 60 343 16 Y 1 C ARG 61 ? C ARG 61 344 16 Y 1 C GLU 62 ? C GLU 62 345 16 Y 1 C THR 63 ? C THR 63 346 16 Y 1 C PRO 64 ? C PRO 64 347 16 Y 1 C HIS 65 ? C HIS 65 348 16 Y 1 C HIS 66 ? C HIS 66 349 16 Y 1 C HIS 67 ? C HIS 67 350 16 Y 1 C HIS 68 ? C HIS 68 351 16 Y 1 C HIS 69 ? C HIS 69 352 16 Y 1 C HIS 70 ? C HIS 70 353 17 Y 1 A LYS 60 ? A LYS 60 354 17 Y 1 A ARG 61 ? A ARG 61 355 17 Y 1 A GLU 62 ? A GLU 62 356 17 Y 1 A THR 63 ? A THR 63 357 17 Y 1 A PRO 64 ? A PRO 64 358 17 Y 1 A HIS 65 ? A HIS 65 359 17 Y 1 A HIS 66 ? A HIS 66 360 17 Y 1 A HIS 67 ? A HIS 67 361 17 Y 1 A HIS 68 ? A HIS 68 362 17 Y 1 A HIS 69 ? A HIS 69 363 17 Y 1 A HIS 70 ? A HIS 70 364 17 Y 1 C LYS 60 ? C LYS 60 365 17 Y 1 C ARG 61 ? C ARG 61 366 17 Y 1 C GLU 62 ? C GLU 62 367 17 Y 1 C THR 63 ? C THR 63 368 17 Y 1 C PRO 64 ? C PRO 64 369 17 Y 1 C HIS 65 ? C HIS 65 370 17 Y 1 C HIS 66 ? C HIS 66 371 17 Y 1 C HIS 67 ? C HIS 67 372 17 Y 1 C HIS 68 ? C HIS 68 373 17 Y 1 C HIS 69 ? C HIS 69 374 17 Y 1 C HIS 70 ? C HIS 70 375 18 Y 1 A LYS 60 ? A LYS 60 376 18 Y 1 A ARG 61 ? A ARG 61 377 18 Y 1 A GLU 62 ? A GLU 62 378 18 Y 1 A THR 63 ? A THR 63 379 18 Y 1 A PRO 64 ? A PRO 64 380 18 Y 1 A HIS 65 ? A HIS 65 381 18 Y 1 A HIS 66 ? A HIS 66 382 18 Y 1 A HIS 67 ? A HIS 67 383 18 Y 1 A HIS 68 ? A HIS 68 384 18 Y 1 A HIS 69 ? A HIS 69 385 18 Y 1 A HIS 70 ? A HIS 70 386 18 Y 1 C LYS 60 ? C LYS 60 387 18 Y 1 C ARG 61 ? C ARG 61 388 18 Y 1 C GLU 62 ? C GLU 62 389 18 Y 1 C THR 63 ? C THR 63 390 18 Y 1 C PRO 64 ? C PRO 64 391 18 Y 1 C HIS 65 ? C HIS 65 392 18 Y 1 C HIS 66 ? C HIS 66 393 18 Y 1 C HIS 67 ? C HIS 67 394 18 Y 1 C HIS 68 ? C HIS 68 395 18 Y 1 C HIS 69 ? C HIS 69 396 18 Y 1 C HIS 70 ? C HIS 70 397 19 Y 1 A LYS 60 ? A LYS 60 398 19 Y 1 A ARG 61 ? A ARG 61 399 19 Y 1 A GLU 62 ? A GLU 62 400 19 Y 1 A THR 63 ? A THR 63 401 19 Y 1 A PRO 64 ? A PRO 64 402 19 Y 1 A HIS 65 ? A HIS 65 403 19 Y 1 A HIS 66 ? A HIS 66 404 19 Y 1 A HIS 67 ? A HIS 67 405 19 Y 1 A HIS 68 ? A HIS 68 406 19 Y 1 A HIS 69 ? A HIS 69 407 19 Y 1 A HIS 70 ? A HIS 70 408 19 Y 1 C LYS 60 ? C LYS 60 409 19 Y 1 C ARG 61 ? C ARG 61 410 19 Y 1 C GLU 62 ? C GLU 62 411 19 Y 1 C THR 63 ? C THR 63 412 19 Y 1 C PRO 64 ? C PRO 64 413 19 Y 1 C HIS 65 ? C HIS 65 414 19 Y 1 C HIS 66 ? C HIS 66 415 19 Y 1 C HIS 67 ? C HIS 67 416 19 Y 1 C HIS 68 ? C HIS 68 417 19 Y 1 C HIS 69 ? C HIS 69 418 19 Y 1 C HIS 70 ? C HIS 70 419 20 Y 1 A LYS 60 ? A LYS 60 420 20 Y 1 A ARG 61 ? A ARG 61 421 20 Y 1 A GLU 62 ? A GLU 62 422 20 Y 1 A THR 63 ? A THR 63 423 20 Y 1 A PRO 64 ? A PRO 64 424 20 Y 1 A HIS 65 ? A HIS 65 425 20 Y 1 A HIS 66 ? A HIS 66 426 20 Y 1 A HIS 67 ? A HIS 67 427 20 Y 1 A HIS 68 ? A HIS 68 428 20 Y 1 A HIS 69 ? A HIS 69 429 20 Y 1 A HIS 70 ? A HIS 70 430 20 Y 1 C LYS 60 ? C LYS 60 431 20 Y 1 C ARG 61 ? C ARG 61 432 20 Y 1 C GLU 62 ? C GLU 62 433 20 Y 1 C THR 63 ? C THR 63 434 20 Y 1 C PRO 64 ? C PRO 64 435 20 Y 1 C HIS 65 ? C HIS 65 436 20 Y 1 C HIS 66 ? C HIS 66 437 20 Y 1 C HIS 67 ? C HIS 67 438 20 Y 1 C HIS 68 ? C HIS 68 439 20 Y 1 C HIS 69 ? C HIS 69 440 20 Y 1 C HIS 70 ? C HIS 70 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 2MFE 'a-form double helix' 2MFE 'hairpin loop' 2MFE 'mismatched base pair' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B G 1 1_555 B C 22 1_555 -0.261 -0.121 -0.269 -5.938 -1.198 -1.006 1 B_G17:C38_B B 17 ? B 38 ? 19 1 1 B G 2 1_555 B C 21 1_555 -0.339 -0.127 0.112 4.699 -1.641 -0.362 2 B_G18:C37_B B 18 ? B 37 ? 19 1 1 B G 3 1_555 B U 20 1_555 -2.269 -0.454 0.162 9.511 -7.629 -1.306 3 B_G19:U36_B B 19 ? B 36 ? 28 1 1 B C 4 1_555 B G 19 1_555 0.225 -0.124 0.142 -0.186 -7.226 -0.581 4 B_C20:G35_B B 20 ? B 35 ? 19 1 1 B C 5 1_555 B G 18 1_555 0.447 -0.195 -0.084 1.723 -9.385 -0.472 5 B_C21:G34_B B 21 ? B 34 ? 19 1 1 B A 6 1_555 B U 17 1_555 0.197 -0.066 0.272 1.710 -0.836 -1.740 6 B_A22:U33_B B 22 ? B 33 ? 20 1 1 B U 7 1_555 B A 16 1_555 0.100 -0.039 0.156 1.472 2.763 -1.766 7 B_U23:A32_B B 23 ? B 32 ? 20 1 1 B C 8 1_555 B G 15 1_555 0.229 -0.161 -0.050 10.864 -5.437 -3.201 8 B_C24:G31_B B 24 ? B 31 ? 19 1 1 D G 1 1_555 D C 22 1_555 -0.295 -0.139 -0.261 -5.218 -2.163 -1.459 9 D_G17:C38_D D 17 ? D 38 ? 19 1 1 D G 2 1_555 D C 21 1_555 -0.380 -0.138 0.136 4.912 -1.098 0.161 10 D_G18:C37_D D 18 ? D 37 ? 19 1 1 D G 3 1_555 D U 20 1_555 -2.306 -0.435 0.175 9.713 -5.332 -0.823 11 D_G19:U36_D D 19 ? D 36 ? 28 1 1 D C 4 1_555 D G 19 1_555 0.266 -0.142 0.122 0.488 -6.156 -0.985 12 D_C20:G35_D D 20 ? D 35 ? 19 1 1 D C 5 1_555 D G 18 1_555 0.433 -0.146 -0.124 2.757 -8.257 0.870 13 D_C21:G34_D D 21 ? D 34 ? 19 1 1 D A 6 1_555 D U 17 1_555 0.227 -0.023 0.330 3.709 -2.678 2.024 14 D_A22:U33_D D 22 ? D 33 ? 20 1 1 D U 7 1_555 D A 16 1_555 0.062 -0.017 0.153 -0.234 3.954 1.257 15 D_U23:A32_D D 23 ? D 32 ? 20 1 1 D C 8 1_555 D G 15 1_555 0.017 -0.096 -0.220 12.994 -0.519 -2.668 16 D_C24:G31_D D 24 ? D 31 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 B G 1 1_555 B C 22 1_555 B G 2 1_555 B C 21 1_555 0.043 -1.694 3.020 -2.740 4.042 26.905 -4.473 -0.693 2.724 8.596 5.827 27.337 1 BB_G17G18:C37C38_BB B 17 ? B 38 ? B 18 ? B 37 ? 1 B G 2 1_555 B C 21 1_555 B G 3 1_555 B U 20 1_555 -0.156 -2.123 2.938 -3.494 8.508 24.283 -6.597 -0.420 2.088 19.359 7.950 25.942 2 BB_G18G19:U36C37_BB B 18 ? B 37 ? B 19 ? B 36 ? 1 B G 3 1_555 B U 20 1_555 B C 4 1_555 B G 19 1_555 0.192 -1.761 3.486 -1.837 6.164 42.442 -3.038 -0.451 3.201 8.456 2.521 42.904 3 BB_G19C20:G35U36_BB B 19 ? B 36 ? B 20 ? B 35 ? 1 B C 4 1_555 B G 19 1_555 B C 5 1_555 B G 18 1_555 0.053 -1.966 3.200 4.169 4.207 32.769 -4.094 0.563 2.917 7.381 -7.315 33.286 4 BB_C20C21:G34G35_BB B 20 ? B 35 ? B 21 ? B 34 ? 1 B C 5 1_555 B G 18 1_555 B A 6 1_555 B U 17 1_555 0.053 -1.814 3.278 -2.205 2.662 30.478 -3.942 -0.525 3.101 5.043 4.178 30.669 5 BB_C21A22:U33G34_BB B 21 ? B 34 ? B 22 ? B 33 ? 1 B A 6 1_555 B U 17 1_555 B U 7 1_555 B A 16 1_555 -0.090 -2.181 3.450 0.990 -1.349 29.384 -3.985 0.404 3.539 -2.656 -1.950 29.430 6 BB_A22U23:A32U33_BB B 22 ? B 33 ? B 23 ? B 32 ? 1 B U 7 1_555 B A 16 1_555 B C 8 1_555 B G 15 1_555 0.058 -2.047 3.285 0.847 -9.430 27.739 -1.790 0.089 3.764 -18.983 -1.706 29.280 7 BB_U23C24:G31A32_BB B 23 ? B 32 ? B 24 ? B 31 ? 1 D G 1 1_555 D C 22 1_555 D G 2 1_555 D C 21 1_555 0.184 -1.716 3.008 -3.050 4.692 26.757 -4.650 -1.051 2.637 10.000 6.500 27.326 8 DD_G17G18:C37C38_DD D 17 ? D 38 ? D 18 ? D 37 ? 1 D G 2 1_555 D C 21 1_555 D G 3 1_555 D U 20 1_555 -0.273 -2.209 2.942 -3.782 8.466 24.427 -6.727 -0.217 2.089 19.148 8.554 26.103 9 DD_G18G19:U36C37_DD D 18 ? D 37 ? D 19 ? D 36 ? 1 D G 3 1_555 D U 20 1_555 D C 4 1_555 D G 19 1_555 0.161 -1.797 3.483 -1.405 6.032 42.443 -3.075 -0.364 3.203 8.279 1.928 42.871 10 DD_G19C20:G35U36_DD D 19 ? D 36 ? D 20 ? D 35 ? 1 D C 4 1_555 D G 19 1_555 D C 5 1_555 D G 18 1_555 0.236 -2.015 3.228 4.219 2.113 32.247 -3.949 0.294 3.099 3.779 -7.546 32.581 11 DD_C20C21:G34G35_DD D 20 ? D 35 ? D 21 ? D 34 ? 1 D C 5 1_555 D G 18 1_555 D A 6 1_555 D U 17 1_555 0.228 -1.918 3.212 -2.528 2.363 29.516 -4.214 -0.952 3.023 4.618 4.941 29.714 12 DD_C21A22:U33G34_DD D 21 ? D 34 ? D 22 ? D 33 ? 1 D A 6 1_555 D U 17 1_555 D U 7 1_555 D A 16 1_555 -0.106 -2.484 3.414 0.518 1.547 27.453 -5.613 0.354 3.269 3.257 -1.091 27.501 13 DD_A22U23:A32U33_DD D 22 ? D 33 ? D 23 ? D 32 ? 1 D U 7 1_555 D A 16 1_555 D C 8 1_555 D G 15 1_555 -0.227 -2.137 3.103 0.998 -7.505 27.052 -2.574 0.712 3.545 -15.658 -2.081 28.072 14 DD_U23C24:G31A32_DD D 23 ? D 32 ? D 24 ? D 31 ? #