data_2MFH # _entry.id 2MFH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MFH RCSB RCSB103565 BMRB 19549 WWPDB D_1000103565 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19549 BMRB unspecified . 2MFC PDB unspecified . 2MFE PDB unspecified . 2MFF PDB unspecified . 2MFG PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MFH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-10-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Duss, O.' 1 'Diarra Dit Konte, N.' 2 'Michel, E.' 3 'Schubert, M.' 4 'Allain, F.H.-T.' 5 # _citation.id primary _citation.title 'Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 42 _citation.page_first 5332 _citation.page_last 5346 _citation.year 2014 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24561806 _citation.pdbx_database_id_DOI 10.1093/nar/gku141 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Duss, O.' 1 primary 'Michel, E.' 2 primary 'Diarra Dit Konte, N.' 3 primary 'Schubert, M.' 4 primary 'Allain, F.H.' 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Carbon storage regulator homolog' 7847.951 2 ? ? ? ? 2 polymer syn 'RsmZ(36-44) RNA' 2855.767 2 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH A,C ? 2 polyribonucleotide no no UCAGGACAU UCAGGACAU B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 ILE n 1 4 LEU n 1 5 THR n 1 6 ARG n 1 7 LYS n 1 8 VAL n 1 9 GLY n 1 10 GLU n 1 11 SER n 1 12 ILE n 1 13 ASN n 1 14 ILE n 1 15 GLY n 1 16 ASP n 1 17 ASP n 1 18 ILE n 1 19 THR n 1 20 ILE n 1 21 THR n 1 22 ILE n 1 23 LEU n 1 24 GLY n 1 25 VAL n 1 26 SER n 1 27 GLY n 1 28 GLN n 1 29 GLN n 1 30 VAL n 1 31 ARG n 1 32 ILE n 1 33 GLY n 1 34 ILE n 1 35 ASN n 1 36 ALA n 1 37 PRO n 1 38 LYS n 1 39 ASP n 1 40 VAL n 1 41 ALA n 1 42 VAL n 1 43 HIS n 1 44 ARG n 1 45 GLU n 1 46 GLU n 1 47 ILE n 1 48 TYR n 1 49 GLN n 1 50 ARG n 1 51 ILE n 1 52 GLN n 1 53 ALA n 1 54 GLY n 1 55 LEU n 1 56 THR n 1 57 ALA n 1 58 PRO n 1 59 ASP n 1 60 LYS n 1 61 ARG n 1 62 GLU n 1 63 THR n 1 64 PRO n 1 65 HIS n 1 66 HIS n 1 67 HIS n 1 68 HIS n 1 69 HIS n 1 70 HIS n 2 1 U n 2 2 C n 2 3 A n 2 4 G n 2 5 G n 2 6 A n 2 7 C n 2 8 A n 2 9 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rsmE, csrA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas fluorescens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 294 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP Q5MXB2_PSEFL Q5MXB2 1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD 1 ? 2 PDB 2MFH 2MFH 2 UCAGGACAU ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2MFH A 1 ? 59 ? Q5MXB2 1 ? 59 ? 1 59 2 1 2MFH C 1 ? 59 ? Q5MXB2 1 ? 59 ? 1 59 3 2 2MFH B 1 ? 9 ? 2MFH 36 ? 44 ? 36 44 4 2 2MFH D 1 ? 9 ? 2MFH 36 ? 44 ? 36 44 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MFH LYS A 60 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 60 1 1 2MFH ARG A 61 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 61 2 1 2MFH GLU A 62 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 62 3 1 2MFH THR A 63 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 63 4 1 2MFH PRO A 64 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 64 5 1 2MFH HIS A 65 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 65 6 1 2MFH HIS A 66 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 66 7 1 2MFH HIS A 67 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 67 8 1 2MFH HIS A 68 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 68 9 1 2MFH HIS A 69 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 69 10 1 2MFH HIS A 70 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 70 11 2 2MFH LYS C 60 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 60 12 2 2MFH ARG C 61 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 61 13 2 2MFH GLU C 62 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 62 14 2 2MFH THR C 63 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 63 15 2 2MFH PRO C 64 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 64 16 2 2MFH HIS C 65 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 65 17 2 2MFH HIS C 66 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 66 18 2 2MFH HIS C 67 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 67 19 2 2MFH HIS C 68 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 68 20 2 2MFH HIS C 69 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 69 21 2 2MFH HIS C 70 ? UNP Q5MXB2 ? ? 'EXPRESSION TAG' 70 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H NOESY' 1 5 4 '2D 1H-13C HSQC' 1 6 3 '3D 1H-13C NOESY aliphatic' 1 7 4 '3D 1Fe3Ff NOESY' 1 8 2 '2D 1H-1H TOCSY' 1 9 5 '2D 1H-15N HSQC' 1 10 6 '2D 1H-13C HSQC' 1 11 6 '3D 1H-13C NOESY' 1 12 6 '3D 1Fe3Ff NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.18 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 15N] RsmE, 1 mM RsmZ(36-44), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1 mM [U-100% 15N] RsmE, 1 mM RsmZ(36-44), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O' 2 '100% D2O' '1 mM [U-100% 13C; U-100% 15N] RsmE, 1 mM RsmZ(36-44), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' '1 mM [U-100% 13C; U-100% 15N] RsmE, 1 mM RsmZ(36-44), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O' 4 '100% D2O' ;1 mM [U-100% 15N] RsmE, 1 mM [U-100% 13C; U-100% 15N] RsmZ(36-44), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 95% H2O/5% D2O ; 5 '95% H2O/5% D2O' '1 mM [U-100% 15N] RsmE, 1 mM [U-100% 13C; U-100% 15N] RsmZ(36-44), 0.05 mM potassium phosphate, 0.03 mM sodium chloride, 100% D2O' 6 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' 700 Bruker Avance 3 'Bruker Avance' 900 Bruker Avance 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MFH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 999 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MFH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 17.1 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.31 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MFH _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' processing TOPSPIN ? 1 Goddard 'chemical shift assignment' SPARKY ? 2 Goddard 'data analysis' SPARKY ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement AMBER ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MFH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MFH _struct.title 'Csr/Rsm protein-RNA recognition - A molecular affinity ruler: RsmZ(36-44)/RsmE(dimer) 2:1 complex' _struct.pdbx_descriptor 'Carbon storage regulator homolog' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MFH _struct_keywords.pdbx_keywords TRANSLATION/RNA _struct_keywords.text ;CsrA, RsmA, RsmE, RsmZ, CsrB, translation repressor protein, translation activation, protein sequestration, bacterial protein, non-coding RNA, sRNA, Pseudomonas aeruginosa, RNA-Binding Proteins, messenger RNA, modulation of binding affinity, molecular mimicry, TRANSLATION-RNA complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 45 ? GLN A 49 ? GLU A 45 GLN A 49 1 ? 5 HELX_P HELX_P2 2 GLU C 45 ? GLN C 52 ? GLU C 45 GLN C 52 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order hydrog1 hydrog ? ? B G 4 N2 ? ? ? 1_555 B G 5 N7 ? ? B G 39 B G 40 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? hydrog2 hydrog ? ? D G 4 N2 ? ? ? 1_555 D G 5 N7 ? ? D G 39 D G 40 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 2 ? LYS A 7 ? LEU A 2 LYS A 7 A 2 GLN C 29 ? ASN C 35 ? GLN C 29 ASN C 35 A 3 ILE C 18 ? SER C 26 ? ILE C 18 SER C 26 A 4 SER C 11 ? ILE C 14 ? SER C 11 ILE C 14 A 5 VAL A 42 ? ARG A 44 ? VAL A 42 ARG A 44 B 1 LEU C 2 ? LYS C 7 ? LEU C 2 LYS C 7 B 2 GLN A 29 ? ASN A 35 ? GLN A 29 ASN A 35 B 3 ILE A 18 ? SER A 26 ? ILE A 18 SER A 26 B 4 SER A 11 ? ILE A 14 ? SER A 11 ILE A 14 B 5 VAL C 42 ? ARG C 44 ? VAL C 42 ARG C 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 4 ? N LEU A 4 O ILE C 32 ? O ILE C 32 A 2 3 O GLY C 33 ? O GLY C 33 N THR C 21 ? N THR C 21 A 3 4 O ILE C 20 ? O ILE C 20 N ILE C 12 ? N ILE C 12 A 4 5 O ASN C 13 ? O ASN C 13 N HIS A 43 ? N HIS A 43 B 1 2 O ARG C 6 ? O ARG C 6 N VAL A 30 ? N VAL A 30 B 2 3 O GLY A 33 ? O GLY A 33 N THR A 21 ? N THR A 21 B 3 4 O ILE A 20 ? O ILE A 20 N ILE A 12 ? N ILE A 12 B 4 5 N ASN A 13 ? N ASN A 13 O HIS C 43 ? O HIS C 43 # _atom_sites.entry_id 2MFH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 ARG 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 THR 63 63 ? ? ? A . n A 1 64 PRO 64 64 ? ? ? A . n A 1 65 HIS 65 65 ? ? ? A . n A 1 66 HIS 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n A 1 68 HIS 68 68 ? ? ? A . n A 1 69 HIS 69 69 ? ? ? A . n A 1 70 HIS 70 70 ? ? ? A . n B 2 1 U 1 36 36 U U B . n B 2 2 C 2 37 37 C C B . n B 2 3 A 3 38 38 A A B . n B 2 4 G 4 39 39 G G B . n B 2 5 G 5 40 40 G G B . n B 2 6 A 6 41 41 A A B . n B 2 7 C 7 42 42 C C B . n B 2 8 A 8 43 43 A A B . n B 2 9 U 9 44 44 U U B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 LEU 2 2 2 LEU LEU C . n C 1 3 ILE 3 3 3 ILE ILE C . n C 1 4 LEU 4 4 4 LEU LEU C . n C 1 5 THR 5 5 5 THR THR C . n C 1 6 ARG 6 6 6 ARG ARG C . n C 1 7 LYS 7 7 7 LYS LYS C . n C 1 8 VAL 8 8 8 VAL VAL C . n C 1 9 GLY 9 9 9 GLY GLY C . n C 1 10 GLU 10 10 10 GLU GLU C . n C 1 11 SER 11 11 11 SER SER C . n C 1 12 ILE 12 12 12 ILE ILE C . n C 1 13 ASN 13 13 13 ASN ASN C . n C 1 14 ILE 14 14 14 ILE ILE C . n C 1 15 GLY 15 15 15 GLY GLY C . n C 1 16 ASP 16 16 16 ASP ASP C . n C 1 17 ASP 17 17 17 ASP ASP C . n C 1 18 ILE 18 18 18 ILE ILE C . n C 1 19 THR 19 19 19 THR THR C . n C 1 20 ILE 20 20 20 ILE ILE C . n C 1 21 THR 21 21 21 THR THR C . n C 1 22 ILE 22 22 22 ILE ILE C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 GLY 24 24 24 GLY GLY C . n C 1 25 VAL 25 25 25 VAL VAL C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 GLY 27 27 27 GLY GLY C . n C 1 28 GLN 28 28 28 GLN GLN C . n C 1 29 GLN 29 29 29 GLN GLN C . n C 1 30 VAL 30 30 30 VAL VAL C . n C 1 31 ARG 31 31 31 ARG ARG C . n C 1 32 ILE 32 32 32 ILE ILE C . n C 1 33 GLY 33 33 33 GLY GLY C . n C 1 34 ILE 34 34 34 ILE ILE C . n C 1 35 ASN 35 35 35 ASN ASN C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 PRO 37 37 37 PRO PRO C . n C 1 38 LYS 38 38 38 LYS LYS C . n C 1 39 ASP 39 39 39 ASP ASP C . n C 1 40 VAL 40 40 40 VAL VAL C . n C 1 41 ALA 41 41 41 ALA ALA C . n C 1 42 VAL 42 42 42 VAL VAL C . n C 1 43 HIS 43 43 43 HIS HIS C . n C 1 44 ARG 44 44 44 ARG ARG C . n C 1 45 GLU 45 45 45 GLU GLU C . n C 1 46 GLU 46 46 46 GLU GLU C . n C 1 47 ILE 47 47 47 ILE ILE C . n C 1 48 TYR 48 48 48 TYR TYR C . n C 1 49 GLN 49 49 49 GLN GLN C . n C 1 50 ARG 50 50 50 ARG ARG C . n C 1 51 ILE 51 51 51 ILE ILE C . n C 1 52 GLN 52 52 52 GLN GLN C . n C 1 53 ALA 53 53 53 ALA ALA C . n C 1 54 GLY 54 54 54 GLY GLY C . n C 1 55 LEU 55 55 55 LEU LEU C . n C 1 56 THR 56 56 56 THR THR C . n C 1 57 ALA 57 57 57 ALA ALA C . n C 1 58 PRO 58 58 58 PRO PRO C . n C 1 59 ASP 59 59 59 ASP ASP C . n C 1 60 LYS 60 60 ? ? ? C . n C 1 61 ARG 61 61 ? ? ? C . n C 1 62 GLU 62 62 ? ? ? C . n C 1 63 THR 63 63 ? ? ? C . n C 1 64 PRO 64 64 ? ? ? C . n C 1 65 HIS 65 65 ? ? ? C . n C 1 66 HIS 66 66 ? ? ? C . n C 1 67 HIS 67 67 ? ? ? C . n C 1 68 HIS 68 68 ? ? ? C . n C 1 69 HIS 69 69 ? ? ? C . n C 1 70 HIS 70 70 ? ? ? C . n D 2 1 U 1 36 36 U U D . n D 2 2 C 2 37 37 C C D . n D 2 3 A 3 38 38 A A D . n D 2 4 G 4 39 39 G G D . n D 2 5 G 5 40 40 G G D . n D 2 6 A 6 41 41 A A D . n D 2 7 C 7 42 42 C C D . n D 2 8 A 8 43 43 A A D . n D 2 9 U 9 44 44 U U D . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7280 ? 1 MORE -32 ? 1 'SSA (A^2)' 8550 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-02-26 2 'Structure model' 1 1 2014-03-26 3 'Structure model' 1 2 2014-05-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RsmE-1 1 ? mM '[U-100% 15N]' 1 'RsmZ(36-44)-2' 1 ? mM ? 1 'potassium phosphate-3' 0.05 ? mM ? 1 'sodium chloride-4' 0.03 ? mM ? 1 RsmE-5 1 ? mM '[U-100% 15N]' 2 'RsmZ(36-44)-6' 1 ? mM ? 2 'potassium phosphate-7' 0.05 ? mM ? 2 'sodium chloride-8' 0.03 ? mM ? 2 RsmE-9 1 ? mM '[U-100% 13C; U-100% 15N]' 3 'RsmZ(36-44)-10' 1 ? mM ? 3 'potassium phosphate-11' 0.05 ? mM ? 3 'sodium chloride-12' 0.03 ? mM ? 3 RsmE-13 1 ? mM '[U-100% 13C; U-100% 15N]' 4 'RsmZ(36-44)-14' 1 ? mM ? 4 'potassium phosphate-15' 0.05 ? mM ? 4 'sodium chloride-16' 0.03 ? mM ? 4 RsmE-17 1 ? mM '[U-100% 15N]' 5 'RsmZ(36-44)-18' 1 ? mM '[U-100% 13C; U-100% 15N]' 5 'potassium phosphate-19' 0.05 ? mM ? 5 'sodium chloride-20' 0.03 ? mM ? 5 RsmE-21 1 ? mM '[U-100% 15N]' 6 'RsmZ(36-44)-22' 1 ? mM '[U-100% 13C; U-100% 15N]' 6 'potassium phosphate-23' 0.05 ? mM ? 6 'sodium chloride-24' 0.03 ? mM ? 6 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MFH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count 14 _pdbx_nmr_constraints.NOE_constraints_total 2490 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 "HO2'" D C 42 ? ? "O5'" D A 43 ? ? 1.57 2 10 "HO2'" D U 36 ? ? OP1 D C 37 ? ? 1.55 3 15 "HO2'" B C 42 ? ? "O5'" B A 43 ? ? 1.60 4 20 "HO2'" B C 42 ? ? "O5'" B A 43 ? ? 1.57 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.09 108.50 4.59 0.70 N 2 1 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 112.77 108.50 4.27 0.70 N 3 2 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.51 108.50 5.01 0.70 N 4 2 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.26 108.50 4.76 0.70 N 5 3 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 114.10 108.50 5.60 0.70 N 6 3 "O4'" D A 38 ? ? "C1'" D A 38 ? ? N9 D A 38 ? ? 112.92 108.50 4.42 0.70 N 7 3 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.67 108.50 5.17 0.70 N 8 4 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.04 108.50 4.54 0.70 N 9 4 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.47 108.50 4.97 0.70 N 10 5 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.31 108.50 4.81 0.70 N 11 5 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 114.28 108.50 5.78 0.70 N 12 6 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.38 108.50 4.88 0.70 N 13 6 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 112.93 108.50 4.43 0.70 N 14 7 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 112.84 108.50 4.34 0.70 N 15 8 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 114.97 108.50 6.47 0.70 N 16 8 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.25 108.50 4.75 0.70 N 17 8 "O4'" D A 43 ? ? "C1'" D A 43 ? ? N9 D A 43 ? ? 114.14 108.50 5.64 0.70 N 18 9 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 115.92 108.50 7.42 0.70 N 19 9 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 114.91 108.50 6.41 0.70 N 20 9 "C3'" D C 42 ? ? "C2'" D C 42 ? ? "C1'" D C 42 ? ? 106.42 101.50 4.92 0.80 N 21 10 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 114.60 108.50 6.10 0.70 N 22 10 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.18 108.50 4.68 0.70 N 23 11 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.48 108.50 4.98 0.70 N 24 11 "C4'" D G 39 ? ? "C3'" D G 39 ? ? "C2'" D G 39 ? ? 96.40 102.60 -6.20 1.00 N 25 11 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.04 108.50 4.54 0.70 N 26 12 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 115.31 108.50 6.81 0.70 N 27 12 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 112.80 108.50 4.30 0.70 N 28 13 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.19 108.50 4.69 0.70 N 29 13 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 114.55 108.50 6.05 0.70 N 30 14 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.30 108.50 4.80 0.70 N 31 14 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.19 108.50 4.69 0.70 N 32 15 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 112.72 108.50 4.22 0.70 N 33 15 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.85 108.50 5.35 0.70 N 34 16 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 115.14 108.50 6.64 0.70 N 35 16 "O4'" D A 38 ? ? "C1'" D A 38 ? ? N9 D A 38 ? ? 112.87 108.50 4.37 0.70 N 36 16 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.59 108.50 5.09 0.70 N 37 17 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 115.55 108.50 7.05 0.70 N 38 17 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 112.98 108.50 4.48 0.70 N 39 17 "O4'" D A 43 ? ? "C1'" D A 43 ? ? N9 D A 43 ? ? 114.96 108.50 6.46 0.70 N 40 18 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 115.52 108.50 7.02 0.70 N 41 18 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 115.44 108.50 6.94 0.70 N 42 19 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.84 108.50 5.34 0.70 N 43 19 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.67 108.50 5.17 0.70 N 44 20 "O4'" B G 40 ? ? "C1'" B G 40 ? ? N9 B G 40 ? ? 113.67 108.50 5.17 0.70 N 45 20 "O4'" D G 40 ? ? "C1'" D G 40 ? ? N9 D G 40 ? ? 113.49 108.50 4.99 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 17 ? ? -143.66 12.06 2 1 SER A 26 ? ? -150.17 89.69 3 1 GLN A 52 ? ? -66.34 1.70 4 1 PRO A 58 ? ? -51.51 172.42 5 1 SER C 26 ? ? -150.46 89.96 6 1 PRO C 58 ? ? -51.83 173.58 7 2 SER A 26 ? ? -152.50 89.72 8 2 LEU A 55 ? ? -151.14 23.19 9 2 PRO A 58 ? ? -50.01 174.13 10 2 SER C 26 ? ? -151.80 89.73 11 2 GLN C 52 ? ? -68.61 2.97 12 2 THR C 56 ? ? -142.33 -1.20 13 2 ALA C 57 ? ? -154.10 76.96 14 3 ASP A 17 ? ? -141.79 11.06 15 3 ALA A 57 ? ? -150.87 78.26 16 3 ASP C 17 ? ? -144.78 12.21 17 3 SER C 26 ? ? -151.01 89.96 18 3 GLN C 52 ? ? -69.37 2.97 19 4 ASP A 17 ? ? -142.47 12.28 20 4 PRO A 58 ? ? -49.69 172.33 21 4 ASP C 17 ? ? -142.73 11.86 22 4 SER C 26 ? ? -152.40 89.47 23 4 GLN C 52 ? ? -68.62 2.66 24 4 PRO C 58 ? ? -50.17 172.58 25 5 ASP A 17 ? ? -141.69 12.60 26 5 PRO A 58 ? ? -52.74 170.28 27 5 ASP C 17 ? ? -143.57 12.06 28 5 SER C 26 ? ? -150.53 89.76 29 5 GLN C 52 ? ? -68.57 3.00 30 5 THR C 56 ? ? -144.53 10.19 31 6 SER A 26 ? ? -151.02 89.41 32 6 THR A 56 ? ? -140.72 -3.21 33 6 PRO A 58 ? ? -50.45 175.79 34 6 ASP C 17 ? ? -143.12 11.28 35 6 SER C 26 ? ? -150.24 85.26 36 6 THR C 56 ? ? -141.98 -2.97 37 7 SER A 26 ? ? -150.04 89.47 38 7 GLN A 52 ? ? -69.41 3.14 39 7 PRO A 58 ? ? -50.29 171.40 40 7 ASP C 17 ? ? -140.18 11.15 41 7 SER C 26 ? ? -151.85 89.81 42 7 LEU C 55 ? ? -150.41 -30.28 43 7 THR C 56 ? ? 32.87 45.75 44 7 PRO C 58 ? ? -49.05 169.27 45 8 ASP A 17 ? ? -141.36 11.50 46 8 SER A 26 ? ? -150.25 89.37 47 8 GLN A 52 ? ? -69.48 2.26 48 8 THR A 56 ? ? -144.58 14.90 49 8 ASP C 17 ? ? -142.31 11.40 50 8 SER C 26 ? ? -150.20 89.26 51 8 LEU C 55 ? ? -146.88 -30.84 52 8 THR C 56 ? ? 44.18 22.70 53 9 ASP A 17 ? ? -140.83 10.99 54 9 SER A 26 ? ? -150.47 89.57 55 9 ALA A 57 ? ? -154.32 79.29 56 9 ASP C 17 ? ? -142.45 10.38 57 9 SER C 26 ? ? -150.78 89.90 58 9 GLN C 52 ? ? -69.98 3.03 59 9 PRO C 58 ? ? -51.11 170.77 60 10 ASP A 17 ? ? -141.88 10.93 61 10 SER A 26 ? ? -150.69 89.41 62 10 PRO A 58 ? ? -50.96 173.57 63 10 ASP C 17 ? ? -141.37 11.01 64 10 SER C 26 ? ? -150.90 89.43 65 10 ALA C 57 ? ? -163.04 -34.80 66 11 ASP A 17 ? ? -144.27 11.94 67 11 SER A 26 ? ? -150.07 89.46 68 11 ALA A 57 ? ? -150.39 81.69 69 11 PRO A 58 ? ? -52.00 176.51 70 11 ASP C 17 ? ? -143.97 11.42 71 11 SER C 26 ? ? -151.17 89.68 72 11 LEU C 55 ? ? -155.22 -22.74 73 11 PRO C 58 ? ? -52.98 177.05 74 12 ASP A 17 ? ? -142.42 11.83 75 12 SER A 26 ? ? -150.21 89.30 76 12 LEU A 55 ? ? -149.45 -36.75 77 12 THR A 56 ? ? 38.58 28.25 78 12 ALA A 57 ? ? -156.76 66.38 79 12 PRO A 58 ? ? -52.82 176.08 80 12 ASP C 17 ? ? -141.09 11.92 81 12 SER C 26 ? ? -150.34 89.74 82 12 ILE C 51 ? ? -100.47 -63.64 83 12 GLN C 52 ? ? -63.19 2.44 84 12 LEU C 55 ? ? -149.96 -28.60 85 12 PRO C 58 ? ? -52.32 177.60 86 13 SER A 26 ? ? -152.03 89.67 87 13 ALA A 57 ? ? -153.22 79.48 88 13 PRO A 58 ? ? -50.83 172.70 89 13 ASP C 17 ? ? -144.12 11.42 90 13 SER C 26 ? ? -151.52 89.46 91 13 GLN C 52 ? ? -69.21 3.07 92 13 ALA C 57 ? ? -151.99 80.88 93 13 PRO C 58 ? ? -50.83 170.06 94 14 ASP A 17 ? ? -142.10 12.65 95 14 LEU A 55 ? ? 69.90 174.88 96 14 ALA A 57 ? ? -151.60 71.37 97 14 PRO A 58 ? ? -52.41 174.22 98 14 ASP C 17 ? ? -142.25 10.67 99 14 SER C 26 ? ? -150.21 89.03 100 14 ALA C 57 ? ? -161.26 104.93 101 15 ASP A 17 ? ? -142.04 10.78 102 15 ILE A 51 ? ? -90.56 -63.34 103 15 GLN A 52 ? ? -64.74 3.54 104 15 LEU A 55 ? ? -150.97 -27.31 105 15 THR A 56 ? ? 48.31 18.73 106 15 ALA A 57 ? ? -157.19 65.25 107 15 PRO A 58 ? ? -52.94 171.83 108 15 ASP C 17 ? ? -141.90 11.31 109 15 LEU C 55 ? ? 58.02 171.59 110 15 ALA C 57 ? ? -154.25 63.41 111 16 ASP A 17 ? ? -143.37 11.06 112 16 SER A 26 ? ? -152.81 89.57 113 16 ALA A 53 ? ? -150.19 4.10 114 16 LEU A 55 ? ? -44.36 152.22 115 16 ASP C 17 ? ? -146.81 13.64 116 16 LEU C 55 ? ? 52.63 -170.01 117 17 SER A 26 ? ? -151.42 89.65 118 17 ALA A 57 ? ? -150.76 77.29 119 17 PRO A 58 ? ? -49.67 153.70 120 17 SER C 26 ? ? -150.91 89.26 121 17 GLN C 52 ? ? -59.71 -3.58 122 17 ALA C 57 ? ? -152.89 79.64 123 17 PRO C 58 ? ? -50.99 174.18 124 18 ASP A 17 ? ? -142.28 11.40 125 18 SER A 26 ? ? -150.37 89.55 126 18 ALA A 57 ? ? -155.43 71.03 127 18 ASP C 17 ? ? -143.20 11.34 128 18 SER C 26 ? ? -150.93 89.57 129 19 ASP A 17 ? ? -143.92 11.95 130 19 SER A 26 ? ? -150.43 75.91 131 19 PRO A 58 ? ? -49.49 154.30 132 19 ASP C 17 ? ? -145.12 12.83 133 19 SER C 26 ? ? -150.40 89.38 134 20 ASP A 17 ? ? -141.77 10.70 135 20 SER A 26 ? ? -151.09 89.69 136 20 ALA A 53 ? ? -141.81 -2.17 137 20 LEU A 55 ? ? 66.44 -179.66 138 20 ASP C 17 ? ? -146.52 13.01 139 20 LEU C 55 ? ? 55.19 -175.26 140 20 ALA C 57 ? ? -152.63 61.89 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 C D 42 ? ? 0.080 'SIDE CHAIN' 2 11 A D 41 ? ? 0.065 'SIDE CHAIN' 3 16 ARG C 6 ? ? 0.090 'SIDE CHAIN' 4 17 A D 43 ? ? 0.088 'SIDE CHAIN' 5 19 G B 40 ? ? 0.053 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 60 ? A LYS 60 2 1 Y 1 A ARG 61 ? A ARG 61 3 1 Y 1 A GLU 62 ? A GLU 62 4 1 Y 1 A THR 63 ? A THR 63 5 1 Y 1 A PRO 64 ? A PRO 64 6 1 Y 1 A HIS 65 ? A HIS 65 7 1 Y 1 A HIS 66 ? A HIS 66 8 1 Y 1 A HIS 67 ? A HIS 67 9 1 Y 1 A HIS 68 ? A HIS 68 10 1 Y 1 A HIS 69 ? A HIS 69 11 1 Y 1 A HIS 70 ? A HIS 70 12 1 Y 1 C LYS 60 ? C LYS 60 13 1 Y 1 C ARG 61 ? C ARG 61 14 1 Y 1 C GLU 62 ? C GLU 62 15 1 Y 1 C THR 63 ? C THR 63 16 1 Y 1 C PRO 64 ? C PRO 64 17 1 Y 1 C HIS 65 ? C HIS 65 18 1 Y 1 C HIS 66 ? C HIS 66 19 1 Y 1 C HIS 67 ? C HIS 67 20 1 Y 1 C HIS 68 ? C HIS 68 21 1 Y 1 C HIS 69 ? C HIS 69 22 1 Y 1 C HIS 70 ? C HIS 70 23 2 Y 1 A LYS 60 ? A LYS 60 24 2 Y 1 A ARG 61 ? A ARG 61 25 2 Y 1 A GLU 62 ? A GLU 62 26 2 Y 1 A THR 63 ? A THR 63 27 2 Y 1 A PRO 64 ? A PRO 64 28 2 Y 1 A HIS 65 ? A HIS 65 29 2 Y 1 A HIS 66 ? A HIS 66 30 2 Y 1 A HIS 67 ? A HIS 67 31 2 Y 1 A HIS 68 ? A HIS 68 32 2 Y 1 A HIS 69 ? A HIS 69 33 2 Y 1 A HIS 70 ? A HIS 70 34 2 Y 1 C LYS 60 ? C LYS 60 35 2 Y 1 C ARG 61 ? C ARG 61 36 2 Y 1 C GLU 62 ? C GLU 62 37 2 Y 1 C THR 63 ? C THR 63 38 2 Y 1 C PRO 64 ? C PRO 64 39 2 Y 1 C HIS 65 ? C HIS 65 40 2 Y 1 C HIS 66 ? C HIS 66 41 2 Y 1 C HIS 67 ? C HIS 67 42 2 Y 1 C HIS 68 ? C HIS 68 43 2 Y 1 C HIS 69 ? C HIS 69 44 2 Y 1 C HIS 70 ? C HIS 70 45 3 Y 1 A LYS 60 ? A LYS 60 46 3 Y 1 A ARG 61 ? A ARG 61 47 3 Y 1 A GLU 62 ? A GLU 62 48 3 Y 1 A THR 63 ? A THR 63 49 3 Y 1 A PRO 64 ? A PRO 64 50 3 Y 1 A HIS 65 ? A HIS 65 51 3 Y 1 A HIS 66 ? A HIS 66 52 3 Y 1 A HIS 67 ? A HIS 67 53 3 Y 1 A HIS 68 ? A HIS 68 54 3 Y 1 A HIS 69 ? A HIS 69 55 3 Y 1 A HIS 70 ? A HIS 70 56 3 Y 1 C LYS 60 ? C LYS 60 57 3 Y 1 C ARG 61 ? C ARG 61 58 3 Y 1 C GLU 62 ? C GLU 62 59 3 Y 1 C THR 63 ? C THR 63 60 3 Y 1 C PRO 64 ? C PRO 64 61 3 Y 1 C HIS 65 ? C HIS 65 62 3 Y 1 C HIS 66 ? C HIS 66 63 3 Y 1 C HIS 67 ? C HIS 67 64 3 Y 1 C HIS 68 ? C HIS 68 65 3 Y 1 C HIS 69 ? C HIS 69 66 3 Y 1 C HIS 70 ? C HIS 70 67 4 Y 1 A LYS 60 ? A LYS 60 68 4 Y 1 A ARG 61 ? A ARG 61 69 4 Y 1 A GLU 62 ? A GLU 62 70 4 Y 1 A THR 63 ? A THR 63 71 4 Y 1 A PRO 64 ? A PRO 64 72 4 Y 1 A HIS 65 ? A HIS 65 73 4 Y 1 A HIS 66 ? A HIS 66 74 4 Y 1 A HIS 67 ? A HIS 67 75 4 Y 1 A HIS 68 ? A HIS 68 76 4 Y 1 A HIS 69 ? A HIS 69 77 4 Y 1 A HIS 70 ? A HIS 70 78 4 Y 1 C LYS 60 ? C LYS 60 79 4 Y 1 C ARG 61 ? C ARG 61 80 4 Y 1 C GLU 62 ? C GLU 62 81 4 Y 1 C THR 63 ? C THR 63 82 4 Y 1 C PRO 64 ? C PRO 64 83 4 Y 1 C HIS 65 ? C HIS 65 84 4 Y 1 C HIS 66 ? C HIS 66 85 4 Y 1 C HIS 67 ? C HIS 67 86 4 Y 1 C HIS 68 ? C HIS 68 87 4 Y 1 C HIS 69 ? C HIS 69 88 4 Y 1 C HIS 70 ? C HIS 70 89 5 Y 1 A LYS 60 ? A LYS 60 90 5 Y 1 A ARG 61 ? A ARG 61 91 5 Y 1 A GLU 62 ? A GLU 62 92 5 Y 1 A THR 63 ? A THR 63 93 5 Y 1 A PRO 64 ? A PRO 64 94 5 Y 1 A HIS 65 ? A HIS 65 95 5 Y 1 A HIS 66 ? A HIS 66 96 5 Y 1 A HIS 67 ? A HIS 67 97 5 Y 1 A HIS 68 ? A HIS 68 98 5 Y 1 A HIS 69 ? A HIS 69 99 5 Y 1 A HIS 70 ? A HIS 70 100 5 Y 1 C LYS 60 ? C LYS 60 101 5 Y 1 C ARG 61 ? C ARG 61 102 5 Y 1 C GLU 62 ? C GLU 62 103 5 Y 1 C THR 63 ? C THR 63 104 5 Y 1 C PRO 64 ? C PRO 64 105 5 Y 1 C HIS 65 ? C HIS 65 106 5 Y 1 C HIS 66 ? C HIS 66 107 5 Y 1 C HIS 67 ? C HIS 67 108 5 Y 1 C HIS 68 ? C HIS 68 109 5 Y 1 C HIS 69 ? C HIS 69 110 5 Y 1 C HIS 70 ? C HIS 70 111 6 Y 1 A LYS 60 ? A LYS 60 112 6 Y 1 A ARG 61 ? A ARG 61 113 6 Y 1 A GLU 62 ? A GLU 62 114 6 Y 1 A THR 63 ? A THR 63 115 6 Y 1 A PRO 64 ? A PRO 64 116 6 Y 1 A HIS 65 ? A HIS 65 117 6 Y 1 A HIS 66 ? A HIS 66 118 6 Y 1 A HIS 67 ? A HIS 67 119 6 Y 1 A HIS 68 ? A HIS 68 120 6 Y 1 A HIS 69 ? A HIS 69 121 6 Y 1 A HIS 70 ? A HIS 70 122 6 Y 1 C LYS 60 ? C LYS 60 123 6 Y 1 C ARG 61 ? C ARG 61 124 6 Y 1 C GLU 62 ? C GLU 62 125 6 Y 1 C THR 63 ? C THR 63 126 6 Y 1 C PRO 64 ? C PRO 64 127 6 Y 1 C HIS 65 ? C HIS 65 128 6 Y 1 C HIS 66 ? C HIS 66 129 6 Y 1 C HIS 67 ? C HIS 67 130 6 Y 1 C HIS 68 ? C HIS 68 131 6 Y 1 C HIS 69 ? C HIS 69 132 6 Y 1 C HIS 70 ? C HIS 70 133 7 Y 1 A LYS 60 ? A LYS 60 134 7 Y 1 A ARG 61 ? A ARG 61 135 7 Y 1 A GLU 62 ? A GLU 62 136 7 Y 1 A THR 63 ? A THR 63 137 7 Y 1 A PRO 64 ? A PRO 64 138 7 Y 1 A HIS 65 ? A HIS 65 139 7 Y 1 A HIS 66 ? A HIS 66 140 7 Y 1 A HIS 67 ? A HIS 67 141 7 Y 1 A HIS 68 ? A HIS 68 142 7 Y 1 A HIS 69 ? A HIS 69 143 7 Y 1 A HIS 70 ? A HIS 70 144 7 Y 1 C LYS 60 ? C LYS 60 145 7 Y 1 C ARG 61 ? C ARG 61 146 7 Y 1 C GLU 62 ? C GLU 62 147 7 Y 1 C THR 63 ? C THR 63 148 7 Y 1 C PRO 64 ? C PRO 64 149 7 Y 1 C HIS 65 ? C HIS 65 150 7 Y 1 C HIS 66 ? C HIS 66 151 7 Y 1 C HIS 67 ? C HIS 67 152 7 Y 1 C HIS 68 ? C HIS 68 153 7 Y 1 C HIS 69 ? C HIS 69 154 7 Y 1 C HIS 70 ? C HIS 70 155 8 Y 1 A LYS 60 ? A LYS 60 156 8 Y 1 A ARG 61 ? A ARG 61 157 8 Y 1 A GLU 62 ? A GLU 62 158 8 Y 1 A THR 63 ? A THR 63 159 8 Y 1 A PRO 64 ? A PRO 64 160 8 Y 1 A HIS 65 ? A HIS 65 161 8 Y 1 A HIS 66 ? A HIS 66 162 8 Y 1 A HIS 67 ? A HIS 67 163 8 Y 1 A HIS 68 ? A HIS 68 164 8 Y 1 A HIS 69 ? A HIS 69 165 8 Y 1 A HIS 70 ? A HIS 70 166 8 Y 1 C LYS 60 ? C LYS 60 167 8 Y 1 C ARG 61 ? C ARG 61 168 8 Y 1 C GLU 62 ? C GLU 62 169 8 Y 1 C THR 63 ? C THR 63 170 8 Y 1 C PRO 64 ? C PRO 64 171 8 Y 1 C HIS 65 ? C HIS 65 172 8 Y 1 C HIS 66 ? C HIS 66 173 8 Y 1 C HIS 67 ? C HIS 67 174 8 Y 1 C HIS 68 ? C HIS 68 175 8 Y 1 C HIS 69 ? C HIS 69 176 8 Y 1 C HIS 70 ? C HIS 70 177 9 Y 1 A LYS 60 ? A LYS 60 178 9 Y 1 A ARG 61 ? A ARG 61 179 9 Y 1 A GLU 62 ? A GLU 62 180 9 Y 1 A THR 63 ? A THR 63 181 9 Y 1 A PRO 64 ? A PRO 64 182 9 Y 1 A HIS 65 ? A HIS 65 183 9 Y 1 A HIS 66 ? A HIS 66 184 9 Y 1 A HIS 67 ? A HIS 67 185 9 Y 1 A HIS 68 ? A HIS 68 186 9 Y 1 A HIS 69 ? A HIS 69 187 9 Y 1 A HIS 70 ? A HIS 70 188 9 Y 1 C LYS 60 ? C LYS 60 189 9 Y 1 C ARG 61 ? C ARG 61 190 9 Y 1 C GLU 62 ? C GLU 62 191 9 Y 1 C THR 63 ? C THR 63 192 9 Y 1 C PRO 64 ? C PRO 64 193 9 Y 1 C HIS 65 ? C HIS 65 194 9 Y 1 C HIS 66 ? C HIS 66 195 9 Y 1 C HIS 67 ? C HIS 67 196 9 Y 1 C HIS 68 ? C HIS 68 197 9 Y 1 C HIS 69 ? C HIS 69 198 9 Y 1 C HIS 70 ? C HIS 70 199 10 Y 1 A LYS 60 ? A LYS 60 200 10 Y 1 A ARG 61 ? A ARG 61 201 10 Y 1 A GLU 62 ? A GLU 62 202 10 Y 1 A THR 63 ? A THR 63 203 10 Y 1 A PRO 64 ? A PRO 64 204 10 Y 1 A HIS 65 ? A HIS 65 205 10 Y 1 A HIS 66 ? A HIS 66 206 10 Y 1 A HIS 67 ? A HIS 67 207 10 Y 1 A HIS 68 ? A HIS 68 208 10 Y 1 A HIS 69 ? A HIS 69 209 10 Y 1 A HIS 70 ? A HIS 70 210 10 Y 1 C LYS 60 ? C LYS 60 211 10 Y 1 C ARG 61 ? C ARG 61 212 10 Y 1 C GLU 62 ? C GLU 62 213 10 Y 1 C THR 63 ? C THR 63 214 10 Y 1 C PRO 64 ? C PRO 64 215 10 Y 1 C HIS 65 ? C HIS 65 216 10 Y 1 C HIS 66 ? C HIS 66 217 10 Y 1 C HIS 67 ? C HIS 67 218 10 Y 1 C HIS 68 ? C HIS 68 219 10 Y 1 C HIS 69 ? C HIS 69 220 10 Y 1 C HIS 70 ? C HIS 70 221 11 Y 1 A LYS 60 ? A LYS 60 222 11 Y 1 A ARG 61 ? A ARG 61 223 11 Y 1 A GLU 62 ? A GLU 62 224 11 Y 1 A THR 63 ? A THR 63 225 11 Y 1 A PRO 64 ? A PRO 64 226 11 Y 1 A HIS 65 ? A HIS 65 227 11 Y 1 A HIS 66 ? A HIS 66 228 11 Y 1 A HIS 67 ? A HIS 67 229 11 Y 1 A HIS 68 ? A HIS 68 230 11 Y 1 A HIS 69 ? A HIS 69 231 11 Y 1 A HIS 70 ? A HIS 70 232 11 Y 1 C LYS 60 ? C LYS 60 233 11 Y 1 C ARG 61 ? C ARG 61 234 11 Y 1 C GLU 62 ? C GLU 62 235 11 Y 1 C THR 63 ? C THR 63 236 11 Y 1 C PRO 64 ? C PRO 64 237 11 Y 1 C HIS 65 ? C HIS 65 238 11 Y 1 C HIS 66 ? C HIS 66 239 11 Y 1 C HIS 67 ? C HIS 67 240 11 Y 1 C HIS 68 ? C HIS 68 241 11 Y 1 C HIS 69 ? C HIS 69 242 11 Y 1 C HIS 70 ? C HIS 70 243 12 Y 1 A LYS 60 ? A LYS 60 244 12 Y 1 A ARG 61 ? A ARG 61 245 12 Y 1 A GLU 62 ? A GLU 62 246 12 Y 1 A THR 63 ? A THR 63 247 12 Y 1 A PRO 64 ? A PRO 64 248 12 Y 1 A HIS 65 ? A HIS 65 249 12 Y 1 A HIS 66 ? A HIS 66 250 12 Y 1 A HIS 67 ? A HIS 67 251 12 Y 1 A HIS 68 ? A HIS 68 252 12 Y 1 A HIS 69 ? A HIS 69 253 12 Y 1 A HIS 70 ? A HIS 70 254 12 Y 1 C LYS 60 ? C LYS 60 255 12 Y 1 C ARG 61 ? C ARG 61 256 12 Y 1 C GLU 62 ? C GLU 62 257 12 Y 1 C THR 63 ? C THR 63 258 12 Y 1 C PRO 64 ? C PRO 64 259 12 Y 1 C HIS 65 ? C HIS 65 260 12 Y 1 C HIS 66 ? C HIS 66 261 12 Y 1 C HIS 67 ? C HIS 67 262 12 Y 1 C HIS 68 ? C HIS 68 263 12 Y 1 C HIS 69 ? C HIS 69 264 12 Y 1 C HIS 70 ? C HIS 70 265 13 Y 1 A LYS 60 ? A LYS 60 266 13 Y 1 A ARG 61 ? A ARG 61 267 13 Y 1 A GLU 62 ? A GLU 62 268 13 Y 1 A THR 63 ? A THR 63 269 13 Y 1 A PRO 64 ? A PRO 64 270 13 Y 1 A HIS 65 ? A HIS 65 271 13 Y 1 A HIS 66 ? A HIS 66 272 13 Y 1 A HIS 67 ? A HIS 67 273 13 Y 1 A HIS 68 ? A HIS 68 274 13 Y 1 A HIS 69 ? A HIS 69 275 13 Y 1 A HIS 70 ? A HIS 70 276 13 Y 1 C LYS 60 ? C LYS 60 277 13 Y 1 C ARG 61 ? C ARG 61 278 13 Y 1 C GLU 62 ? C GLU 62 279 13 Y 1 C THR 63 ? C THR 63 280 13 Y 1 C PRO 64 ? C PRO 64 281 13 Y 1 C HIS 65 ? C HIS 65 282 13 Y 1 C HIS 66 ? C HIS 66 283 13 Y 1 C HIS 67 ? C HIS 67 284 13 Y 1 C HIS 68 ? C HIS 68 285 13 Y 1 C HIS 69 ? C HIS 69 286 13 Y 1 C HIS 70 ? C HIS 70 287 14 Y 1 A LYS 60 ? A LYS 60 288 14 Y 1 A ARG 61 ? A ARG 61 289 14 Y 1 A GLU 62 ? A GLU 62 290 14 Y 1 A THR 63 ? A THR 63 291 14 Y 1 A PRO 64 ? A PRO 64 292 14 Y 1 A HIS 65 ? A HIS 65 293 14 Y 1 A HIS 66 ? A HIS 66 294 14 Y 1 A HIS 67 ? A HIS 67 295 14 Y 1 A HIS 68 ? A HIS 68 296 14 Y 1 A HIS 69 ? A HIS 69 297 14 Y 1 A HIS 70 ? A HIS 70 298 14 Y 1 C LYS 60 ? C LYS 60 299 14 Y 1 C ARG 61 ? C ARG 61 300 14 Y 1 C GLU 62 ? C GLU 62 301 14 Y 1 C THR 63 ? C THR 63 302 14 Y 1 C PRO 64 ? C PRO 64 303 14 Y 1 C HIS 65 ? C HIS 65 304 14 Y 1 C HIS 66 ? C HIS 66 305 14 Y 1 C HIS 67 ? C HIS 67 306 14 Y 1 C HIS 68 ? C HIS 68 307 14 Y 1 C HIS 69 ? C HIS 69 308 14 Y 1 C HIS 70 ? C HIS 70 309 15 Y 1 A LYS 60 ? A LYS 60 310 15 Y 1 A ARG 61 ? A ARG 61 311 15 Y 1 A GLU 62 ? A GLU 62 312 15 Y 1 A THR 63 ? A THR 63 313 15 Y 1 A PRO 64 ? A PRO 64 314 15 Y 1 A HIS 65 ? A HIS 65 315 15 Y 1 A HIS 66 ? A HIS 66 316 15 Y 1 A HIS 67 ? A HIS 67 317 15 Y 1 A HIS 68 ? A HIS 68 318 15 Y 1 A HIS 69 ? A HIS 69 319 15 Y 1 A HIS 70 ? A HIS 70 320 15 Y 1 C LYS 60 ? C LYS 60 321 15 Y 1 C ARG 61 ? C ARG 61 322 15 Y 1 C GLU 62 ? C GLU 62 323 15 Y 1 C THR 63 ? C THR 63 324 15 Y 1 C PRO 64 ? C PRO 64 325 15 Y 1 C HIS 65 ? C HIS 65 326 15 Y 1 C HIS 66 ? C HIS 66 327 15 Y 1 C HIS 67 ? C HIS 67 328 15 Y 1 C HIS 68 ? C HIS 68 329 15 Y 1 C HIS 69 ? C HIS 69 330 15 Y 1 C HIS 70 ? C HIS 70 331 16 Y 1 A LYS 60 ? A LYS 60 332 16 Y 1 A ARG 61 ? A ARG 61 333 16 Y 1 A GLU 62 ? A GLU 62 334 16 Y 1 A THR 63 ? A THR 63 335 16 Y 1 A PRO 64 ? A PRO 64 336 16 Y 1 A HIS 65 ? A HIS 65 337 16 Y 1 A HIS 66 ? A HIS 66 338 16 Y 1 A HIS 67 ? A HIS 67 339 16 Y 1 A HIS 68 ? A HIS 68 340 16 Y 1 A HIS 69 ? A HIS 69 341 16 Y 1 A HIS 70 ? A HIS 70 342 16 Y 1 C LYS 60 ? C LYS 60 343 16 Y 1 C ARG 61 ? C ARG 61 344 16 Y 1 C GLU 62 ? C GLU 62 345 16 Y 1 C THR 63 ? C THR 63 346 16 Y 1 C PRO 64 ? C PRO 64 347 16 Y 1 C HIS 65 ? C HIS 65 348 16 Y 1 C HIS 66 ? C HIS 66 349 16 Y 1 C HIS 67 ? C HIS 67 350 16 Y 1 C HIS 68 ? C HIS 68 351 16 Y 1 C HIS 69 ? C HIS 69 352 16 Y 1 C HIS 70 ? C HIS 70 353 17 Y 1 A LYS 60 ? A LYS 60 354 17 Y 1 A ARG 61 ? A ARG 61 355 17 Y 1 A GLU 62 ? A GLU 62 356 17 Y 1 A THR 63 ? A THR 63 357 17 Y 1 A PRO 64 ? A PRO 64 358 17 Y 1 A HIS 65 ? A HIS 65 359 17 Y 1 A HIS 66 ? A HIS 66 360 17 Y 1 A HIS 67 ? A HIS 67 361 17 Y 1 A HIS 68 ? A HIS 68 362 17 Y 1 A HIS 69 ? A HIS 69 363 17 Y 1 A HIS 70 ? A HIS 70 364 17 Y 1 C LYS 60 ? C LYS 60 365 17 Y 1 C ARG 61 ? C ARG 61 366 17 Y 1 C GLU 62 ? C GLU 62 367 17 Y 1 C THR 63 ? C THR 63 368 17 Y 1 C PRO 64 ? C PRO 64 369 17 Y 1 C HIS 65 ? C HIS 65 370 17 Y 1 C HIS 66 ? C HIS 66 371 17 Y 1 C HIS 67 ? C HIS 67 372 17 Y 1 C HIS 68 ? C HIS 68 373 17 Y 1 C HIS 69 ? C HIS 69 374 17 Y 1 C HIS 70 ? C HIS 70 375 18 Y 1 A LYS 60 ? A LYS 60 376 18 Y 1 A ARG 61 ? A ARG 61 377 18 Y 1 A GLU 62 ? A GLU 62 378 18 Y 1 A THR 63 ? A THR 63 379 18 Y 1 A PRO 64 ? A PRO 64 380 18 Y 1 A HIS 65 ? A HIS 65 381 18 Y 1 A HIS 66 ? A HIS 66 382 18 Y 1 A HIS 67 ? A HIS 67 383 18 Y 1 A HIS 68 ? A HIS 68 384 18 Y 1 A HIS 69 ? A HIS 69 385 18 Y 1 A HIS 70 ? A HIS 70 386 18 Y 1 C LYS 60 ? C LYS 60 387 18 Y 1 C ARG 61 ? C ARG 61 388 18 Y 1 C GLU 62 ? C GLU 62 389 18 Y 1 C THR 63 ? C THR 63 390 18 Y 1 C PRO 64 ? C PRO 64 391 18 Y 1 C HIS 65 ? C HIS 65 392 18 Y 1 C HIS 66 ? C HIS 66 393 18 Y 1 C HIS 67 ? C HIS 67 394 18 Y 1 C HIS 68 ? C HIS 68 395 18 Y 1 C HIS 69 ? C HIS 69 396 18 Y 1 C HIS 70 ? C HIS 70 397 19 Y 1 A LYS 60 ? A LYS 60 398 19 Y 1 A ARG 61 ? A ARG 61 399 19 Y 1 A GLU 62 ? A GLU 62 400 19 Y 1 A THR 63 ? A THR 63 401 19 Y 1 A PRO 64 ? A PRO 64 402 19 Y 1 A HIS 65 ? A HIS 65 403 19 Y 1 A HIS 66 ? A HIS 66 404 19 Y 1 A HIS 67 ? A HIS 67 405 19 Y 1 A HIS 68 ? A HIS 68 406 19 Y 1 A HIS 69 ? A HIS 69 407 19 Y 1 A HIS 70 ? A HIS 70 408 19 Y 1 C LYS 60 ? C LYS 60 409 19 Y 1 C ARG 61 ? C ARG 61 410 19 Y 1 C GLU 62 ? C GLU 62 411 19 Y 1 C THR 63 ? C THR 63 412 19 Y 1 C PRO 64 ? C PRO 64 413 19 Y 1 C HIS 65 ? C HIS 65 414 19 Y 1 C HIS 66 ? C HIS 66 415 19 Y 1 C HIS 67 ? C HIS 67 416 19 Y 1 C HIS 68 ? C HIS 68 417 19 Y 1 C HIS 69 ? C HIS 69 418 19 Y 1 C HIS 70 ? C HIS 70 419 20 Y 1 A LYS 60 ? A LYS 60 420 20 Y 1 A ARG 61 ? A ARG 61 421 20 Y 1 A GLU 62 ? A GLU 62 422 20 Y 1 A THR 63 ? A THR 63 423 20 Y 1 A PRO 64 ? A PRO 64 424 20 Y 1 A HIS 65 ? A HIS 65 425 20 Y 1 A HIS 66 ? A HIS 66 426 20 Y 1 A HIS 67 ? A HIS 67 427 20 Y 1 A HIS 68 ? A HIS 68 428 20 Y 1 A HIS 69 ? A HIS 69 429 20 Y 1 A HIS 70 ? A HIS 70 430 20 Y 1 C LYS 60 ? C LYS 60 431 20 Y 1 C ARG 61 ? C ARG 61 432 20 Y 1 C GLU 62 ? C GLU 62 433 20 Y 1 C THR 63 ? C THR 63 434 20 Y 1 C PRO 64 ? C PRO 64 435 20 Y 1 C HIS 65 ? C HIS 65 436 20 Y 1 C HIS 66 ? C HIS 66 437 20 Y 1 C HIS 67 ? C HIS 67 438 20 Y 1 C HIS 68 ? C HIS 68 439 20 Y 1 C HIS 69 ? C HIS 69 440 20 Y 1 C HIS 70 ? C HIS 70 # _ndb_struct_conf_na.entry_id 2MFH _ndb_struct_conf_na.feature 'double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B G 4 1_555 B G 5 1_555 6.347 4.256 -0.620 -23.475 60.088 18.191 1 B_G39:G40_B B 39 ? B 40 ? ? ? 1 D G 4 1_555 D G 5 1_555 6.376 4.263 -1.209 -14.645 55.095 16.655 2 D_G39:G40_D D 39 ? D 40 ? ? ? #