data_2MFJ # _entry.id 2MFJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MFJ pdb_00002mfj 10.2210/pdb2mfj/pdb RCSB RCSB103567 ? ? BMRB 19552 ? ? WWPDB D_1000103567 ? ? # _pdbx_database_related.db_id 19552 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MFJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-10-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Naik, M.T.' 1 'Naik, N.' 2 'Huang, T.' 3 # _citation.id primary _citation.title 'Solution structure of Blo 1 19' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Naik, M.' 1 ? primary 'Naik, N.' 2 ? primary 'Kuo, I.' 3 ? primary 'Liao, Y.' 4 ? primary 'Huang, T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Blo t 19' _entity.formula_weight 6945.833 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSALDFTSCARMNDGALGAKVAQAACISSCKFQNCGTGHCERRGGRPTCVCSRCGNGGGEWPNLPSRG _entity_poly.pdbx_seq_one_letter_code_can GSALDFTSCARMNDGALGAKVAQAACISSCKFQNCGTGHCERRGGRPTCVCSRCGNGGGEWPNLPSRG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 LEU n 1 5 ASP n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 CYS n 1 10 ALA n 1 11 ARG n 1 12 MET n 1 13 ASN n 1 14 ASP n 1 15 GLY n 1 16 ALA n 1 17 LEU n 1 18 GLY n 1 19 ALA n 1 20 LYS n 1 21 VAL n 1 22 ALA n 1 23 GLN n 1 24 ALA n 1 25 ALA n 1 26 CYS n 1 27 ILE n 1 28 SER n 1 29 SER n 1 30 CYS n 1 31 LYS n 1 32 PHE n 1 33 GLN n 1 34 ASN n 1 35 CYS n 1 36 GLY n 1 37 THR n 1 38 GLY n 1 39 HIS n 1 40 CYS n 1 41 GLU n 1 42 ARG n 1 43 ARG n 1 44 GLY n 1 45 GLY n 1 46 ARG n 1 47 PRO n 1 48 THR n 1 49 CYS n 1 50 VAL n 1 51 CYS n 1 52 SER n 1 53 ARG n 1 54 CYS n 1 55 GLY n 1 56 ASN n 1 57 GLY n 1 58 GLY n 1 59 GLY n 1 60 GLU n 1 61 TRP n 1 62 PRO n 1 63 ASN n 1 64 LEU n 1 65 PRO n 1 66 SER n 1 67 ARG n 1 68 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Blomia tropicalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 40697 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGEX4T-1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2MFJ _struct_ref.pdbx_db_accession 2MFJ _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MFJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2MFJ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CA)CO' 1 5 1 '3D HNCA' 1 6 1 '3D HNCACB' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D HNHA' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 2D-hbCBcgcdHD 1 12 1 2D-hbCBcgcdceHE 1 13 3 2D-TOCSY 1 14 2 '3D 1H-15N TOCSY' 1 15 3 '2D 1H-1H NOESY' 1 16 1 '3D 1H-13C NOESYHSQC' 1 17 1 '3D 1H-15N NOESYHSQC' 1 18 4 '2D 1H-15N IPAP HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] Blo t 19-1, 50 mM potassium phosphate-2, 100 mM sodium chloride-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] Blo t 19-4, 50 mM potassium phosphate-5, 100 mM sodium chloride-6, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1 mM Blo t 19-7, 50 mM potassium phosphate-8, 100 mM sodium chloride-9, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' '1 mM [U-100% 15N] Blo t 19-10, 50 mM potassium phosphate-11, 100 mM sodium chloride-12, 15 mg/ml Pf1 phage-13, 90% H2O/10% D2O' 4 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' 850 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MFJ _pdbx_nmr_refine.method 'torsion angle dynamics, DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ;Initial structure ensemble was calculated by semi-automated NOESY assignment by CYANA. The assignments were manually verified in Sparky and final structure annealing was performed in CYANA. Structure and restraints from CYANA were imported in Xplor-NIH for explicit water refinement. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2MFJ _pdbx_nmr_details.text 'NMR data was acquired at 295K using Shigemi NMR tubes.' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.08688 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MFJ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.90 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.70 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method PSVS # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MFJ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 3.0 'Bruker Biospin' processing TopSpin 2 3.0 Goddard 'chemical shift assignment' Sparky 3 ? Goddard 'peak picking' Sparky 4 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 5 3.9 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 6 3.9 'Bhattacharya and Montelione' validation PSVS 7 1.5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 8 2.34 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 9 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;The data from this entry were used to determine structure of Blo t 19. Due to Proline isomerization, Blo t 19 spectrum has degenerate resonances for a stretch of six residues in its C-terminus. These two populations have varying intensities and are unambiguously assigned as major and minor population. Solution structure is calculated for the Major population. ; _exptl.entry_id 2MFJ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MFJ _struct.title 'Solution structure of Blo t 19, a minor dust mite allergen from Blomia tropicalis' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MFJ _struct_keywords.pdbx_keywords ALLERGEN _struct_keywords.text 'Allergen, Anti-microbial Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 9 ? ASN A 13 ? CYS A 9 ASN A 13 5 ? 5 HELX_P HELX_P2 2 ASP A 14 ? GLN A 33 ? ASP A 14 GLN A 33 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 9 A CYS 40 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 26 A CYS 49 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 30 A CYS 51 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf4 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 35 A CYS 54 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 35 ? ARG A 43 ? CYS A 35 ARG A 43 A 2 ARG A 46 ? CYS A 54 ? ARG A 46 CYS A 54 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 36 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 53 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 53 # _atom_sites.entry_id 2MFJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLY 68 68 68 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-11-19 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.entry_id 2MFJ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'FIRST TWO RESIDUES (GS) ARE EXPRESSION TAGS.' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.02648 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.02581 _pdbx_nmr_ensemble_rms.entry_id 2MFJ _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Blo t 19-1' 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'potassium phosphate-2' 50 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'Blo t 19-4' 1 ? mM '[U-100% 15N]' 2 'potassium phosphate-5' 50 ? mM ? 2 'sodium chloride-6' 100 ? mM ? 2 'Blo t 19-7' 1 ? mM ? 3 'potassium phosphate-8' 50 ? mM ? 3 'sodium chloride-9' 100 ? mM ? 3 'Blo t 19-10' 1 ? mM '[U-100% 15N]' 4 'potassium phosphate-11' 50 ? mM ? 4 'sodium chloride-12' 100 ? mM ? 4 'Pf1 phage-13' 15 ? mg/mL ? 4 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 12 _pdbx_nmr_constraints.entry_id 2MFJ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 54 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1140 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 212 _pdbx_nmr_constraints.NOE_long_range_total_count 294 _pdbx_nmr_constraints.NOE_medium_range_total_count 314 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 320 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 43 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 39 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 39 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 64 ? ? 59.36 87.13 2 2 PRO A 47 ? ? -69.85 98.93 3 2 ASN A 63 ? ? -145.84 10.56 4 2 LEU A 64 ? ? 62.11 80.67 5 3 LEU A 64 ? ? 68.60 123.41 6 3 PRO A 65 ? ? -51.02 174.21 7 3 SER A 66 ? ? -161.12 89.23 8 4 ASN A 34 ? ? 71.26 46.04 9 4 LEU A 64 ? ? 53.52 92.25 10 5 ASN A 34 ? ? 71.23 32.09 11 5 LEU A 64 ? ? 64.27 98.16 12 5 SER A 66 ? ? -83.46 38.97 13 6 ASN A 34 ? ? 70.75 48.54 14 6 PRO A 47 ? ? -67.89 97.09 15 7 ASN A 34 ? ? 70.20 32.77 16 7 TRP A 61 ? ? -154.38 80.03 17 7 LEU A 64 ? ? 71.78 86.58 18 8 GLU A 60 ? ? -163.36 -22.36 19 8 LEU A 64 ? ? 70.76 85.85 20 9 ASN A 34 ? ? 71.13 31.71 21 9 LEU A 64 ? ? 54.57 86.52 22 10 ASN A 34 ? ? 71.75 42.19 23 10 ASN A 56 ? ? -100.41 76.95 24 10 TRP A 61 ? ? -155.73 89.80 25 10 LEU A 64 ? ? 66.79 93.74 26 11 PRO A 62 ? ? -62.36 87.51 27 11 LEU A 64 ? ? 65.04 93.56 28 12 SER A 2 ? ? 49.37 27.17 29 12 ASN A 34 ? ? 70.21 36.72 30 12 ASN A 56 ? ? 57.82 78.10 31 12 LEU A 64 ? ? 70.27 86.93 32 13 ASN A 34 ? ? 70.16 42.42 33 13 PRO A 47 ? ? -60.16 97.30 34 13 LEU A 64 ? ? 54.20 89.91 35 14 ASN A 56 ? ? -96.70 -153.77 36 14 LEU A 64 ? ? 62.60 80.10 37 14 ARG A 67 ? ? -94.43 -65.88 38 15 ASN A 34 ? ? 70.13 38.72 39 15 TRP A 61 ? ? -162.18 63.81 40 15 LEU A 64 ? ? 71.73 107.31 41 16 ASN A 34 ? ? 71.08 49.08 42 16 LEU A 64 ? ? 57.84 71.39 43 17 ASN A 63 ? ? -142.58 13.60 44 17 LEU A 64 ? ? 60.29 84.53 45 18 ASN A 34 ? ? 70.09 49.36 46 18 LEU A 64 ? ? 68.46 105.57 47 18 PRO A 65 ? ? -76.41 34.44 48 19 ASN A 56 ? ? -132.41 -53.58 49 19 LEU A 64 ? ? 64.66 89.04 50 20 ASN A 34 ? ? 71.42 37.63 51 20 LEU A 64 ? ? 46.11 103.71 #