data_2MHP # _entry.id 2MHP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MHP pdb_00002mhp 10.2210/pdb2mhp/pdb RCSB RCSB103629 ? ? BMRB 19646 ? ? WWPDB D_1000103629 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19646 BMRB unspecified . 2MHQ PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MHP _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-12-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shiltagh, N.' 1 'Kirkpatrick, J.' 2 'Cabrita, L.D.' 3 'McKinnon, T.A.J.' 4 'Thalassinos, K.' 5 'Tuddenham, E.G.D.' 6 'Hansen, D.F.' 7 # _citation.id primary _citation.title 'Solution structure of the major factor VIII binding region on von Willebrand factor.' _citation.journal_abbrev Blood _citation.journal_volume 123 _citation.page_first 4143 _citation.page_last 4151 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1528-0020 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24700780 _citation.pdbx_database_id_DOI 10.1182/blood-2013-07-517086 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shiltagh, N.' 1 ? primary 'Kirkpatrick, J.' 2 ? primary 'Cabrita, L.D.' 3 ? primary 'McKinnon, T.A.' 4 ? primary 'Thalassinos, K.' 5 ? primary 'Tuddenham, E.G.' 6 ? primary 'Hansen, D.F.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'von Willebrand factor' _entity.formula_weight 11351.278 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ;domains TIL' and E', UNP residues 766-864 ; _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'vWF, von Willebrand antigen 2, von Willebrand antigen II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGET VKIGCNTCVCRDRKWNCTDHVCD ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGET VKIGCNTCVCRDRKWNCTDHVCD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 CYS n 1 7 ARG n 1 8 PRO n 1 9 PRO n 1 10 MET n 1 11 VAL n 1 12 LYS n 1 13 LEU n 1 14 VAL n 1 15 CYS n 1 16 PRO n 1 17 ALA n 1 18 ASP n 1 19 ASN n 1 20 LEU n 1 21 ARG n 1 22 ALA n 1 23 GLU n 1 24 GLY n 1 25 LEU n 1 26 GLU n 1 27 CYS n 1 28 THR n 1 29 LYS n 1 30 THR n 1 31 CYS n 1 32 GLN n 1 33 ASN n 1 34 TYR n 1 35 ASP n 1 36 LEU n 1 37 GLU n 1 38 CYS n 1 39 MET n 1 40 SER n 1 41 MET n 1 42 GLY n 1 43 CYS n 1 44 VAL n 1 45 SER n 1 46 GLY n 1 47 CYS n 1 48 LEU n 1 49 CYS n 1 50 PRO n 1 51 PRO n 1 52 GLY n 1 53 MET n 1 54 VAL n 1 55 ARG n 1 56 HIS n 1 57 GLU n 1 58 ASN n 1 59 ARG n 1 60 CYS n 1 61 VAL n 1 62 ALA n 1 63 LEU n 1 64 GLU n 1 65 ARG n 1 66 CYS n 1 67 PRO n 1 68 CYS n 1 69 PHE n 1 70 HIS n 1 71 GLN n 1 72 GLY n 1 73 LYS n 1 74 GLU n 1 75 TYR n 1 76 ALA n 1 77 PRO n 1 78 GLY n 1 79 GLU n 1 80 THR n 1 81 VAL n 1 82 LYS n 1 83 ILE n 1 84 GLY n 1 85 CYS n 1 86 ASN n 1 87 THR n 1 88 CYS n 1 89 VAL n 1 90 CYS n 1 91 ARG n 1 92 ASP n 1 93 ARG n 1 94 LYS n 1 95 TRP n 1 96 ASN n 1 97 CYS n 1 98 THR n 1 99 ASP n 1 100 HIS n 1 101 VAL n 1 102 CYS n 1 103 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'VWF, F8VWF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K12 _entity_src_gen.pdbx_host_org_variant Shuffle _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET32b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VWF_HUMAN _struct_ref.pdbx_db_accession P04275 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIG CNTCVCQDRKWNCTDHVCD ; _struct_ref.pdbx_align_begin 766 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MHP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04275 _struct_ref_seq.db_align_beg 766 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 864 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MHP GLY A 1 ? UNP P04275 ? ? 'expression tag' 1 1 1 2MHP ALA A 2 ? UNP P04275 ? ? 'expression tag' 2 2 1 2MHP MET A 3 ? UNP P04275 ? ? 'expression tag' 3 3 1 2MHP GLY A 4 ? UNP P04275 ? ? 'expression tag' 4 4 1 2MHP ARG A 91 ? UNP P04275 GLN 852 'SEE REMARK 999' 91 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D HN(CO)CA' 1 4 1 '3D HNCACB' 1 5 1 '3D 15N HSQC-NOESY-15N HSQC' 1 6 1 '3D HN(CACO)NH' 1 7 1 '3D (H)CC(CO)NH' 1 8 1 '3D H(CCCO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 2 '2D constant-time 1H-13C HSQC' 1 11 1 '3D 1H-15N NOESY' 1 12 4 '3D 1H-13C NOESY' 1 13 3 '{1H}15N steady-state NOE' 1 14 3 '15N R1rho relaxation' 1 15 3 '15N R1 relaxation' 1 16 5 '15N R2-CPMG relaxation dispersion' 1 17 5 '15N R2-CPMG relaxation dispersion' 1 18 6 '2D IPAP-15N HSQC' 1 19 7 '2D IPAP-15N HSQC' 1 20 8 '2D IPAP-15N HSQC' 1 21 6 '2D IPAP-E.COSY-15N HSQC' 1 22 8 '2D IPAP-E.COSY-15N HSQC' 1 23 6 '3D IPAP-HNCO(J-CA)' 1 24 8 '3D IPAP-HNCO(J-CA)' 1 25 6 '3D HN(CO)CA(J-CB)' 1 26 8 '3D HN(CO)CA(J-CB)' 1 27 6 '3D IPAP-(HA)CA(CO)NH' 1 28 8 '3D IPAP-(HA)CA(CO)NH' 1 29 1 '2D 1H-15N HSQC' 1 30 1 '2D 1H-13C HSQC' 1 31 1 '2D constant-time 1H-13C HSQC' 1 32 4 '2D 1H-13C HSQC' 1 33 4 '2D constant-time 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;300 mM [U-13C; U-15N] VWF TIL'E'-1, 20 mM sodium phosphate-2, 100 mM sodium chloride-3, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;300 mM [U-10% 13C] VWF TIL'E'-4, 20 mM sodium phosphate-5, 100 mM sodium chloride-6, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;300 mM [U-15N] VWF TIL'E'-7, 20 mM sodium phosphate-8, 100 mM sodium chloride-9, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' ;300 mM [U-13C; U-15N] VWF TIL'E'-10, 20 mM sodium phosphate-11, 100 mM sodium chloride-12, 90% H2O/10% D2O ; 4 '90% H2O/10% D2O' ;300 mM [U-15N] VWF TIL'E'-13, 20 mM sodium phosphate-14, 100 mM sodium chloride-15, 90% H2O/10% D2O ; 5 '90% H2O/10% D2O' ;300 mM [U-13C; U-15N] VWF TIL'E'-16, 20 mM sodium phosphate-17, 100 mM sodium chloride-18, 90% H2O/10% D2O ; 6 '90% H2O/10% D2O' ;300 mM [U-13C; U-15N] VWF TIL'E'-19, 20 mM sodium phosphate-20, 100 mM sodium chloride-21, 5 mg/mL Pf1 phage-22, 90% H2O/10% D2O ; 7 '90% H2O/10% D2O' ;300 mM [U-13C; U-15N] VWF TIL'E'-23, 20 mM sodium phosphate-24, 100 mM sodium chloride-25, 2 % w/v pentaethylene glycol dodecyl ether-26, 50 mM n-hexanol-27, 90% H2O/10% D2O ; 8 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Bruker 'AVANCE III' 2 'Bruker Avance III' 700 Bruker 'AVANCE III' 3 'Bruker Avance III' # _pdbx_nmr_refine.entry_id 2MHP _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'Each structure in the ensemble was calculated individually.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MHP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MHP _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version Varian collection VnmrJ 1 2.2D 'Bruker Biospin' collection TopSpin 2 2.1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 3 ? Goddard 'chemical shift assignment' Sparky 4 ? Goddard 'peak picking' Sparky 5 ? 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' Xplor-NIH 6 ? ? refinement Xplor-NIH 7 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MHP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MHP _struct.title 'Solution structure of the major factor VIII binding region on von Willebrand factor' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MHP _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' _struct_keywords.text 'von Willebrand factor, factor VIII, BLOOD CLOTTING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 64 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 66 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 64 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 66 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 6 A CYS 47 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 15 A CYS 43 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 27 A CYS 38 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf4 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 31 A CYS 66 1_555 ? ? ? ? ? ? ? 2.014 ? ? disulf5 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 49 A CYS 60 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf6 disulf ? ? A CYS 68 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 68 A CYS 90 1_555 ? ? ? ? ? ? ? 2.004 ? ? disulf7 disulf ? ? A CYS 85 SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 85 A CYS 102 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf8 disulf ? ? A CYS 88 SG ? ? ? 1_555 A CYS 97 SG ? ? A CYS 88 A CYS 97 1_555 ? ? ? ? ? ? ? 2.024 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 11 ? LEU A 13 ? VAL A 11 LEU A 13 A 2 GLY A 46 ? LEU A 48 ? GLY A 46 LEU A 48 B 1 MET A 53 ? HIS A 56 ? MET A 53 HIS A 56 B 2 ARG A 59 ? ALA A 62 ? ARG A 59 ALA A 62 C 1 CYS A 68 ? PHE A 69 ? CYS A 68 PHE A 69 C 2 GLU A 74 ? TYR A 75 ? GLU A 74 TYR A 75 D 1 THR A 80 ? ILE A 83 ? THR A 80 ILE A 83 D 2 ASN A 86 ? ARG A 91 ? ASN A 86 ARG A 91 D 3 LYS A 94 ? CYS A 97 ? LYS A 94 CYS A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 13 ? N LEU A 13 O GLY A 46 ? O GLY A 46 B 1 2 N HIS A 56 ? N HIS A 56 O ARG A 59 ? O ARG A 59 C 1 2 N CYS A 68 ? N CYS A 68 O TYR A 75 ? O TYR A 75 D 1 2 N ILE A 83 ? N ILE A 83 O ASN A 86 ? O ASN A 86 D 2 3 N ARG A 91 ? N ARG A 91 O LYS A 94 ? O LYS A 94 # _atom_sites.entry_id 2MHP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 ASP 103 103 103 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-14 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' struct_ref_seq_dif 7 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 2 'Structure model' '_database_2.pdbx_DOI' 7 2 'Structure model' '_database_2.pdbx_database_accession' 8 2 'Structure model' '_pdbx_nmr_software.name' 9 2 'Structure model' '_pdbx_nmr_spectrometer.model' 10 2 'Structure model' '_struct_ref_seq_dif.details' 11 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 2MHP _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'Q91R (UNP RESIDUE 852) IS NATURAL VARIANT ACCORDING TO DATABASE P04275 (VWF_HUMAN), UNIPROTKB/SWISS-PROT.' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ;VWF TIL'E'-1 ; 300 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 ;VWF TIL'E'-4 ; 300 ? mM '[U-10% 13C]' 2 'sodium phosphate-5' 20 ? mM ? 2 'sodium chloride-6' 100 ? mM ? 2 ;VWF TIL'E'-7 ; 300 ? mM '[U-15N]' 3 'sodium phosphate-8' 20 ? mM ? 3 'sodium chloride-9' 100 ? mM ? 3 ;VWF TIL'E'-10 ; 300 ? mM '[U-13C; U-15N]' 4 'sodium phosphate-11' 20 ? mM ? 4 'sodium chloride-12' 100 ? mM ? 4 ;VWF TIL'E'-13 ; 300 ? mM '[U-15N]' 5 'sodium phosphate-14' 20 ? mM ? 5 'sodium chloride-15' 100 ? mM ? 5 ;VWF TIL'E'-16 ; 300 ? mM '[U-13C; U-15N]' 6 'sodium phosphate-17' 20 ? mM ? 6 'sodium chloride-18' 100 ? mM ? 6 ;VWF TIL'E'-19 ; 300 ? mM '[U-13C; U-15N]' 7 'sodium phosphate-20' 20 ? mM ? 7 'sodium chloride-21' 100 ? mM ? 7 'Pf1 phage-22' 5 ? mg/mL ? 7 ;VWF TIL'E'-23 ; 300 ? mM '[U-13C; U-15N]' 8 'sodium phosphate-24' 20 ? mM ? 8 'sodium chloride-25' 100 ? mM ? 8 'pentaethylene glycol dodecyl ether-26' 2 ? % ? 8 n-hexanol-27 50 ? mM ? 8 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 68 ? ? H A TYR 75 ? ? 1.48 2 1 H A ARG 91 ? ? O A LYS 94 ? ? 1.57 3 1 O A THR 30 ? ? H A TYR 34 ? ? 1.59 4 1 H A ILE 83 ? ? O A ASN 86 ? ? 1.59 5 2 H A HIS 56 ? ? O A ARG 59 ? ? 1.50 6 2 O A THR 30 ? ? H A TYR 34 ? ? 1.52 7 2 O A HIS 56 ? ? H A ARG 59 ? ? 1.53 8 3 H A ILE 83 ? ? O A ASN 86 ? ? 1.55 9 3 O A HIS 56 ? ? H A ARG 59 ? ? 1.57 10 3 H A ARG 91 ? ? O A LYS 94 ? ? 1.59 11 4 H A ILE 83 ? ? O A ASN 86 ? ? 1.38 12 4 H A HIS 56 ? ? O A ARG 59 ? ? 1.48 13 4 O A CYS 68 ? ? H A TYR 75 ? ? 1.54 14 4 O A THR 30 ? ? H A TYR 34 ? ? 1.54 15 4 H A ARG 91 ? ? O A LYS 94 ? ? 1.57 16 4 O A HIS 56 ? ? H A ARG 59 ? ? 1.59 17 5 H A HIS 56 ? ? O A ARG 59 ? ? 1.53 18 5 H A ALA 76 ? ? OE1 A GLU 79 ? ? 1.55 19 5 O A HIS 56 ? ? H A ARG 59 ? ? 1.57 20 5 O A CYS 68 ? ? H A TYR 75 ? ? 1.59 21 6 HG1 A THR 30 ? ? HE21 A GLN 32 ? ? 1.25 22 6 H A THR 87 ? ? HE2 A HIS 100 ? ? 1.33 23 6 H3 A GLY 1 ? ? H A ALA 2 ? ? 1.35 24 6 O A CYS 68 ? ? H A TYR 75 ? ? 1.50 25 6 H A ILE 83 ? ? O A ASN 86 ? ? 1.53 26 6 H A HIS 56 ? ? O A ARG 59 ? ? 1.56 27 6 H A ARG 91 ? ? O A LYS 94 ? ? 1.58 28 7 H A ILE 83 ? ? O A ASN 86 ? ? 1.49 29 7 O A CYS 68 ? ? H A TYR 75 ? ? 1.53 30 7 H A HIS 56 ? ? O A ARG 59 ? ? 1.56 31 7 O A GLY 84 ? ? H A ASN 86 ? ? 1.57 32 7 O A THR 30 ? ? H A TYR 34 ? ? 1.60 33 8 H A THR 30 ? ? HD22 A ASN 33 ? ? 1.20 34 8 H A HIS 56 ? ? O A ARG 59 ? ? 1.47 35 8 H A ARG 91 ? ? O A LYS 94 ? ? 1.58 36 9 H A HIS 56 ? ? O A ARG 59 ? ? 1.47 37 9 H A ILE 83 ? ? O A ASN 86 ? ? 1.51 38 9 O A THR 30 ? ? H A TYR 34 ? ? 1.55 39 9 O A GLY 84 ? ? H A ASN 86 ? ? 1.57 40 9 H A ARG 91 ? ? O A LYS 94 ? ? 1.57 41 10 H A HIS 56 ? ? O A ARG 59 ? ? 1.44 42 10 O A THR 30 ? ? H A TYR 34 ? ? 1.55 43 10 H A ARG 91 ? ? O A LYS 94 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? 53.12 8.01 2 1 ARG A 7 ? ? 49.42 178.05 3 1 PRO A 8 ? ? -44.89 105.43 4 1 PRO A 16 ? ? -46.00 -179.30 5 1 GLU A 23 ? ? 51.17 11.80 6 1 CYS A 27 ? ? -152.16 -48.56 7 1 CYS A 31 ? ? -46.46 -17.05 8 1 GLU A 37 ? ? -48.70 152.94 9 1 SER A 45 ? ? 20.32 92.57 10 1 PRO A 50 ? ? -38.47 165.69 11 1 GLN A 71 ? ? 87.81 36.10 12 1 ARG A 93 ? ? 54.23 12.24 13 1 CYS A 102 ? ? -66.82 69.46 14 2 CYS A 6 ? ? -60.24 81.96 15 2 MET A 10 ? ? -122.32 -58.79 16 2 PRO A 16 ? ? -46.32 179.24 17 2 ARG A 21 ? ? -149.77 52.29 18 2 CYS A 27 ? ? -154.61 -124.90 19 2 CYS A 31 ? ? -52.12 -4.89 20 2 MET A 39 ? ? -66.06 -178.88 21 2 SER A 40 ? ? -47.31 88.83 22 2 CYS A 43 ? ? 52.99 100.31 23 2 GLU A 57 ? ? 45.72 26.64 24 2 ASN A 58 ? ? 88.56 10.27 25 2 ARG A 93 ? ? 54.47 12.22 26 2 HIS A 100 ? ? -59.60 171.27 27 2 CYS A 102 ? ? -63.09 70.77 28 3 SER A 5 ? ? -56.26 -173.82 29 3 CYS A 6 ? ? 56.72 96.85 30 3 MET A 10 ? ? -128.96 -59.45 31 3 PRO A 16 ? ? -46.31 177.79 32 3 ARG A 21 ? ? -142.26 55.52 33 3 CYS A 27 ? ? -40.32 -76.13 34 3 CYS A 31 ? ? -50.42 -4.68 35 3 SER A 40 ? ? -68.30 61.63 36 3 CYS A 43 ? ? 65.47 96.30 37 3 PRO A 50 ? ? -34.20 158.58 38 3 CYS A 85 ? ? 63.35 -29.36 39 3 ARG A 93 ? ? 55.99 11.93 40 4 MET A 3 ? ? 46.18 21.41 41 4 ARG A 7 ? ? -38.83 162.30 42 4 PRO A 8 ? ? -31.51 104.94 43 4 PRO A 16 ? ? -47.27 178.76 44 4 ASN A 19 ? ? 65.42 61.63 45 4 ARG A 21 ? ? -150.38 56.07 46 4 GLU A 23 ? ? 38.40 29.47 47 4 GLU A 26 ? ? 57.16 -78.68 48 4 CYS A 27 ? ? -78.43 -144.69 49 4 THR A 28 ? ? -86.69 -157.16 50 4 CYS A 31 ? ? -59.15 1.37 51 4 PRO A 50 ? ? -61.55 -179.84 52 4 ASN A 58 ? ? 83.71 11.43 53 4 CYS A 85 ? ? 41.48 13.67 54 4 ARG A 93 ? ? 55.92 11.95 55 5 CYS A 6 ? ? -40.73 153.56 56 5 ARG A 7 ? ? -40.04 163.97 57 5 PRO A 8 ? ? -31.02 107.73 58 5 PRO A 16 ? ? -45.26 -179.30 59 5 LEU A 25 ? ? -71.58 -88.03 60 5 SER A 40 ? ? -61.82 71.95 61 5 CYS A 43 ? ? -73.59 49.08 62 5 SER A 45 ? ? 20.34 98.82 63 5 GLN A 71 ? ? 83.10 37.87 64 5 ARG A 93 ? ? 55.59 9.27 65 5 VAL A 101 ? ? -38.24 126.00 66 6 SER A 5 ? ? 44.20 89.10 67 6 CYS A 6 ? ? -82.87 40.69 68 6 ARG A 7 ? ? 56.26 159.93 69 6 PRO A 8 ? ? -31.17 105.71 70 6 PRO A 16 ? ? -46.17 179.19 71 6 CYS A 27 ? ? 40.00 -138.11 72 6 CYS A 31 ? ? -59.26 6.45 73 6 GLU A 37 ? ? -41.63 153.41 74 6 SER A 40 ? ? -68.70 62.49 75 6 CYS A 43 ? ? 66.16 92.50 76 6 PRO A 50 ? ? -42.11 173.58 77 6 CYS A 85 ? ? 70.78 -29.74 78 6 ARG A 93 ? ? 57.63 10.14 79 7 CYS A 6 ? ? -140.93 37.58 80 7 ARG A 7 ? ? 57.96 159.25 81 7 PRO A 8 ? ? -30.05 104.66 82 7 PRO A 16 ? ? -46.42 179.33 83 7 ASN A 19 ? ? 61.08 66.57 84 7 GLU A 23 ? ? -145.12 -35.50 85 7 LEU A 25 ? ? -79.42 -159.55 86 7 THR A 28 ? ? -98.72 -122.90 87 7 CYS A 31 ? ? -49.45 -13.22 88 7 GLU A 37 ? ? -42.49 164.28 89 7 CYS A 38 ? ? 78.48 103.05 90 7 MET A 39 ? ? -161.35 -167.73 91 7 SER A 40 ? ? 49.77 97.70 92 7 CYS A 43 ? ? -71.30 44.65 93 7 PRO A 50 ? ? -37.14 158.25 94 7 CYS A 85 ? ? 64.76 -37.42 95 7 ARG A 93 ? ? 53.36 15.52 96 7 VAL A 101 ? ? -39.11 149.73 97 8 CYS A 6 ? ? 52.96 168.52 98 8 ARG A 7 ? ? -40.72 165.08 99 8 PRO A 8 ? ? -33.01 105.54 100 8 PRO A 16 ? ? -50.04 178.53 101 8 ARG A 21 ? ? -149.96 55.80 102 8 GLU A 23 ? ? 54.57 167.77 103 8 CYS A 27 ? ? 59.01 -169.84 104 8 CYS A 31 ? ? -60.27 7.08 105 8 GLU A 37 ? ? -41.89 159.65 106 8 VAL A 44 ? ? -157.77 86.77 107 8 SER A 45 ? ? 15.77 96.93 108 8 PRO A 67 ? ? -48.86 153.55 109 8 ARG A 93 ? ? 56.61 9.46 110 8 ASP A 99 ? ? 80.02 11.49 111 9 PRO A 9 ? ? -59.99 96.39 112 9 VAL A 11 ? ? 56.74 128.06 113 9 PRO A 16 ? ? -46.17 178.30 114 9 ARG A 21 ? ? -149.11 51.84 115 9 GLU A 23 ? ? -177.17 34.93 116 9 GLU A 26 ? ? -42.84 166.51 117 9 CYS A 27 ? ? 82.74 10.11 118 9 THR A 28 ? ? -49.55 -79.78 119 9 SER A 40 ? ? -174.53 85.99 120 9 CYS A 85 ? ? 62.89 -33.46 121 9 ARG A 93 ? ? 51.23 19.11 122 9 CYS A 102 ? ? -65.38 95.01 123 10 MET A 10 ? ? -120.29 -58.33 124 10 PRO A 16 ? ? -47.85 -179.98 125 10 ALA A 22 ? ? -171.75 96.69 126 10 LEU A 25 ? ? 54.67 163.19 127 10 CYS A 27 ? ? -160.04 -153.87 128 10 THR A 28 ? ? -154.62 -154.39 129 10 CYS A 31 ? ? -47.83 -13.50 130 10 MET A 39 ? ? 30.17 35.67 131 10 SER A 40 ? ? 39.21 -108.36 132 10 MET A 41 ? ? -141.85 -23.70 133 10 CYS A 43 ? ? -96.03 54.50 134 10 PRO A 50 ? ? -40.51 157.29 135 10 ARG A 93 ? ? 55.68 9.83 136 10 ASP A 99 ? ? 77.35 -0.51 137 10 HIS A 100 ? ? -42.60 170.65 138 10 CYS A 102 ? ? -60.59 74.12 #