data_2MHY # _entry.id 2MHY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MHY pdb_00002mhy 10.2210/pdb2mhy/pdb RCSB RCSB103635 ? ? BMRB 19660 ? ? WWPDB D_1000103635 ? ? # _pdbx_database_related.db_id 19660 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MHY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-12-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wilburn, D.B.' 1 'Bowen, K.E.' 2 'Doty, K.A.' 3 'Arumugam, S.' 4 'Lane, A.N.' 5 'Feldhoff, P.W.' 6 'Feldhoff, R.C.' 7 # _citation.id primary _citation.title ;Structural insights into the evolution of a sexy protein: novel topology and restricted backbone flexibility in a hypervariable pheromone from the red-legged salamander, Plethodon shermani. ; _citation.journal_abbrev 'Plos One' _citation.journal_volume 9 _citation.page_first e96975 _citation.page_last e96975 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24849290 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0096975 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wilburn, D.B.' 1 ? primary 'Bowen, K.E.' 2 ? primary 'Doty, K.A.' 3 ? primary 'Arumugam, S.' 4 ? primary 'Lane, A.N.' 5 ? primary 'Feldhoff, P.W.' 6 ? primary 'Feldhoff, R.C.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Plethodontid modulating factor' _entity.formula_weight 6267.848 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 20-76' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN _entity_poly.pdbx_seq_one_letter_code_can LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLN n 1 3 CYS n 1 4 ASN n 1 5 THR n 1 6 LEU n 1 7 ASP n 1 8 GLY n 1 9 GLY n 1 10 THR n 1 11 GLU n 1 12 GLU n 1 13 CYS n 1 14 ILE n 1 15 PRO n 1 16 GLY n 1 17 ILE n 1 18 TYR n 1 19 ASN n 1 20 VAL n 1 21 CYS n 1 22 VAL n 1 23 HIS n 1 24 TYR n 1 25 LYS n 1 26 SER n 1 27 GLU n 1 28 ASP n 1 29 GLU n 1 30 GLU n 1 31 TYR n 1 32 LYS n 1 33 SER n 1 34 CYS n 1 35 GLY n 1 36 ILE n 1 37 GLN n 1 38 GLU n 1 39 GLU n 1 40 CYS n 1 41 GLU n 1 42 ASP n 1 43 ALA n 1 44 GLU n 1 45 GLY n 1 46 ALA n 1 47 THR n 1 48 VAL n 1 49 LEU n 1 50 CYS n 1 51 CYS n 1 52 PRO n 1 53 GLU n 1 54 ASP n 1 55 LEU n 1 56 CYS n 1 57 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Sherman salamander' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plethodon shermani' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 263671 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 4922 _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain KM71H _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPICZalphaA _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0GB44_9SALA _struct_ref.pdbx_db_accession Q0GB44 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN _struct_ref.pdbx_align_begin 20 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MHY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0GB44 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 57 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '3D HNCO' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D 1H-15N TOCSY' 1 6 1 '2D 1H-13C HSQC' 1 7 1 '2D 1H-1H TOCSY' 1 8 1 '2D 1H-1H COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 20 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '2.2 mM [U-98% 15N] rPMF-G, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MHY _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MHY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MHY _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' collection NMRPipe ? 2 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 3 Goddard 'chemical shift assignment' Sparky ? 4 ? refinement CYANA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MHY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MHY _struct.title 'Structure determination of the salamander courtship pheromone Plethodontid Modulating Factor' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MHY _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'pheromone, salamander, PMF, three-finger protein, TFP, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 36 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 41 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 36 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 41 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 13 SG ? ? A CYS 3 A CYS 13 1_555 ? ? ? ? ? ? ? 2.106 ? ? disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 21 A CYS 50 1_555 ? ? ? ? ? ? ? 1.852 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 2 ? ASN A 4 ? GLN A 2 ASN A 4 A 2 THR A 10 ? GLU A 12 ? THR A 10 GLU A 12 B 1 HIS A 23 ? LYS A 25 ? HIS A 23 LYS A 25 B 2 GLU A 30 ? LYS A 32 ? GLU A 30 LYS A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 3 ? N CYS A 3 O GLU A 11 ? O GLU A 11 B 1 2 N TYR A 24 ? N TYR A 24 O TYR A 31 ? O TYR A 31 # _atom_sites.entry_id 2MHY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-01-01 2 'Structure model' 1 1 2014-07-09 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_exptl_sample.component rPMF-G-1 _pdbx_nmr_exptl_sample.concentration 2.2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-98% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.37 2 1 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.66 3 2 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.38 4 2 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.68 5 3 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.39 6 3 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.63 7 4 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.39 8 4 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.61 9 5 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.40 10 5 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.64 11 6 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.38 12 6 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.64 13 7 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.37 14 7 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.63 15 8 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.35 16 8 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.65 17 9 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.39 18 9 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.75 19 10 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.39 20 10 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.65 21 11 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.38 22 11 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.64 23 12 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.40 24 12 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.82 25 13 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.34 26 13 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.64 27 14 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.37 28 14 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.81 29 15 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.38 30 15 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.65 31 16 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.34 32 16 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.66 33 17 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.34 34 17 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.63 35 18 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.42 36 18 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.81 37 19 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.34 38 19 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.64 39 20 SG A CYS 34 ? ? SG A CYS 40 ? ? 1.35 40 20 SG A CYS 51 ? ? SG A CYS 56 ? ? 1.65 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 17 ? ? -143.38 -68.10 2 1 CYS A 34 ? ? 179.30 -169.15 3 1 ALA A 43 ? ? -68.10 87.20 4 2 PRO A 15 ? ? -69.73 85.89 5 2 CYS A 34 ? ? 179.21 -168.66 6 2 ALA A 43 ? ? -53.54 101.62 7 3 PRO A 15 ? ? -69.72 87.77 8 3 CYS A 34 ? ? 179.10 -168.47 9 4 PRO A 15 ? ? -69.78 78.40 10 4 CYS A 34 ? ? 179.09 -168.98 11 4 ALA A 43 ? ? -69.31 85.54 12 5 PRO A 15 ? ? -69.76 78.29 13 5 CYS A 34 ? ? 179.24 -168.52 14 5 ALA A 43 ? ? -68.15 86.77 15 6 CYS A 34 ? ? 179.44 -168.45 16 6 ALA A 43 ? ? -67.07 88.49 17 7 CYS A 34 ? ? 179.34 -168.97 18 8 ILE A 17 ? ? -143.00 -69.36 19 8 CYS A 34 ? ? 179.39 -168.69 20 9 PRO A 15 ? ? -69.80 79.60 21 9 CYS A 34 ? ? 179.28 -169.44 22 9 ALA A 43 ? ? -69.01 85.41 23 10 ILE A 17 ? ? -144.81 -56.12 24 10 CYS A 34 ? ? 179.46 -169.13 25 10 ALA A 43 ? ? -67.87 87.32 26 11 PRO A 15 ? ? -69.75 78.17 27 11 CYS A 34 ? ? 179.27 -168.71 28 11 ALA A 43 ? ? -69.60 84.68 29 12 ILE A 17 ? ? -143.62 -69.03 30 12 CYS A 34 ? ? 179.54 -168.87 31 12 LEU A 55 ? ? 60.33 60.96 32 13 CYS A 34 ? ? 179.41 -168.33 33 13 ALA A 43 ? ? -63.65 92.68 34 14 PRO A 15 ? ? -69.75 78.04 35 14 CYS A 34 ? ? 179.28 -168.71 36 14 ALA A 43 ? ? -69.90 84.15 37 15 PRO A 15 ? ? -69.77 78.11 38 15 CYS A 34 ? ? 179.68 -169.23 39 16 CYS A 34 ? ? 179.34 -168.43 40 17 CYS A 34 ? ? 179.71 -169.49 41 17 ALA A 43 ? ? -68.08 86.87 42 18 PRO A 15 ? ? -69.69 77.60 43 18 CYS A 34 ? ? 179.51 -169.45 44 18 LEU A 55 ? ? 60.27 61.02 45 19 ILE A 17 ? ? -122.39 -66.18 46 19 CYS A 34 ? ? 179.43 -169.17 47 20 TYR A 18 ? ? 64.97 109.01 48 20 CYS A 34 ? ? 179.35 -170.16 #