data_2MI5 # _entry.id 2MI5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MI5 pdb_00002mi5 10.2210/pdb2mi5/pdb RCSB RCSB103642 ? ? BMRB 19666 ? ? WWPDB D_1000103642 ? ? # _pdbx_database_related.db_id 19666 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MI5 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-12-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bende, N.S.' 1 'Mobli, M.' 2 'King, G.F.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a.' 'Nat Commun' 5 4350 4350 2014 ? UK 2041-1723 ? ? 25014760 10.1038/ncomms5350 1 'Characterization and cloning of insecticidal peptides from the primitive weaving spider Diguetia canities.' 'Insect Biochem.Mol.Biol.' 25 991 1000 1995 ? UK 0965-1748 ? ? 8541888 ? 2 'Mode of action of an insecticidal peptide toxin from the venom of a weaving spider (Diguetia canities).' Toxicon 34 1072 1075 1996 TOXIA6 UK 0041-0101 2043 ? 8896202 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bende, N.S.' 1 ? primary 'Dziemborowicz, S.' 2 ? primary 'Mobli, M.' 3 ? primary 'Herzig, V.' 4 ? primary 'Gilchrist, J.' 5 ? primary 'Wagner, J.' 6 ? primary 'Nicholson, G.M.' 7 ? primary 'King, G.F.' 8 ? primary 'Bosmans, F.' 9 ? 1 'Krapcho, K.J.' 10 ? 1 'Kral, R.M.' 11 ? 1 'Vanwagenen, B.C.' 12 ? 1 'Eppler, K.G.' 13 ? 1 'Morgan, T.K.' 14 ? 2 'Bloomquist, J.R.' 15 ? 2 'Kinne, L.P.' 16 ? 2 'Deutsch, V.' 17 ? 2 'Simpson, S.F.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Mu-diguetoxin-Dc1a _entity.formula_weight 6502.441 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mu-DGTX-Dc1a, Insecticidal toxin DTX9.2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SAKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV _entity_poly.pdbx_seq_one_letter_code_can SAKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 LYS n 1 4 ASP n 1 5 GLY n 1 6 ASP n 1 7 VAL n 1 8 GLU n 1 9 GLY n 1 10 PRO n 1 11 ALA n 1 12 GLY n 1 13 CYS n 1 14 LYS n 1 15 LYS n 1 16 TYR n 1 17 ASP n 1 18 VAL n 1 19 GLU n 1 20 CYS n 1 21 ASP n 1 22 SER n 1 23 GLY n 1 24 GLU n 1 25 CYS n 1 26 CYS n 1 27 GLN n 1 28 LYS n 1 29 GLN n 1 30 TYR n 1 31 LEU n 1 32 TRP n 1 33 TYR n 1 34 LYS n 1 35 TRP n 1 36 ARG n 1 37 PRO n 1 38 LEU n 1 39 ASP n 1 40 CYS n 1 41 ARG n 1 42 CYS n 1 43 LEU n 1 44 LYS n 1 45 SER n 1 46 GLY n 1 47 PHE n 1 48 PHE n 1 49 SER n 1 50 SER n 1 51 LYS n 1 52 CYS n 1 53 VAL n 1 54 CYS n 1 55 ARG n 1 56 ASP n 1 57 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Desert bush spider' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Diguetia canities' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 38407 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pLIC _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXI92_DIGCA _struct_ref.pdbx_db_accession P49126 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV _struct_ref.pdbx_align_begin 39 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MI5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49126 _struct_ref_seq.db_align_beg 39 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 57 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MI5 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P49126 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'SEE REMARK 999' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCACB' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '4D HCC(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '350 uM [U-99% 13C; U-99% 15N] Dc1a-1, 20 mM sodium acetate-2, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MI5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2MI5 _pdbx_nmr_details.text 'All 3D and 4D except NOESY type data were acquired using non-uniform sampling and processed using maximum entropy.' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'Best MolProbity score' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MI5 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MI5 _pdbx_nmr_representative.selection_criteria 'best molprobity score' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 3 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS 2 + 'Bartels et al.' 'chemical shift assignment' XEASY 3 ? 'Bruker Biospin' collection TopSpin 4 3 'Jeffrey C. Hoch, Alan S. Stern' processing Rowland_NMR_Toolkit 5 3 'Mehdi Mobli' processing GENPROC 6 2 ? refinement CYANA 7 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MI5 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MI5 _struct.title 'Structure of insect-specific sodium channel toxin mu-Dc1a' _struct.pdbx_model_details 'Best MolProbity score, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MI5 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text ;spider venom, insecticidal toxin, sodium channel, voltage-sensor, gating modifier, non-uniform sampling, DTX9.2, toxin, inhibitor cystine knot, knottin ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 13 A CYS 26 1_555 ? ? ? ? ? ? ? 2.094 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 20 A CYS 40 1_555 ? ? ? ? ? ? ? 1.976 ? ? disulf3 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 25 A CYS 54 1_555 ? ? ? ? ? ? ? 1.977 ? ? disulf4 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 42 A CYS 52 1_555 ? ? ? ? ? ? ? 1.979 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 7 ? GLU A 8 ? VAL A 7 GLU A 8 A 2 LYS A 28 ? LEU A 31 ? LYS A 28 LEU A 31 A 3 LYS A 34 ? ARG A 36 ? LYS A 34 ARG A 36 B 1 LEU A 38 ? LEU A 43 ? LEU A 38 LEU A 43 B 2 LYS A 51 ? ASP A 56 ? LYS A 51 ASP A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 8 ? N GLU A 8 O LYS A 28 ? O LYS A 28 A 2 3 N LEU A 31 ? N LEU A 31 O LYS A 34 ? O LYS A 34 B 1 2 N ARG A 41 ? N ARG A 41 O VAL A 53 ? O VAL A 53 # _atom_sites.entry_id 2MI5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-23 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.sequence_details 'VESTIGE OF PROTEASE RECOGNITION SITE' _pdbx_entry_details.entry_id 2MI5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Dc1a-1 350 ? uM '[U-99% 13C; U-99% 15N]' 1 'sodium acetate-2' 20 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MI5 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 902 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 267 _pdbx_nmr_constraints.NOE_long_range_total_count 276 _pdbx_nmr_constraints.NOE_medium_range_total_count 106 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 253 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 13 ? ? -77.44 -169.84 2 1 CYS A 26 ? ? -54.75 171.01 3 2 CYS A 13 ? ? -64.04 -169.94 4 2 CYS A 26 ? ? -57.20 172.87 5 4 CYS A 26 ? ? -53.41 171.44 6 5 CYS A 13 ? ? -63.93 -170.21 7 5 CYS A 26 ? ? -53.23 172.11 8 6 CYS A 13 ? ? -66.53 -170.65 9 7 CYS A 13 ? ? -74.70 -169.70 10 8 CYS A 13 ? ? -64.07 -169.71 11 8 CYS A 26 ? ? -53.95 173.00 12 9 CYS A 13 ? ? -64.03 -169.90 13 9 CYS A 26 ? ? -55.48 172.57 14 10 CYS A 13 ? ? -78.45 -169.72 15 10 CYS A 26 ? ? -53.37 172.29 16 11 CYS A 13 ? ? -63.94 -169.70 17 12 CYS A 13 ? ? -70.95 -169.84 18 12 CYS A 40 ? ? -68.43 94.97 19 13 CYS A 13 ? ? -64.10 -170.25 20 13 CYS A 26 ? ? -54.96 170.57 21 14 CYS A 13 ? ? -66.39 -169.74 22 14 CYS A 26 ? ? -54.79 175.02 23 15 CYS A 40 ? ? -68.87 90.14 24 16 CYS A 26 ? ? -55.33 174.06 25 16 CYS A 40 ? ? -63.20 92.75 26 17 CYS A 13 ? ? -64.02 -169.78 27 17 CYS A 26 ? ? -52.76 170.63 28 18 CYS A 13 ? ? -74.39 -169.76 29 18 CYS A 26 ? ? -56.57 176.38 30 19 CYS A 26 ? ? -53.52 170.10 #