data_2MK6 # _entry.id 2MK6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MK6 pdb_00002mk6 10.2210/pdb2mk6/pdb RCSB RCSB103711 ? ? BMRB 19755 ? ? WWPDB D_1000103711 ? ? # _pdbx_database_related.db_id 19755 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MK6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-01-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.-H.' 1 'Zhang, Y.' 2 'Jin, C.' 3 'Shi, Y.' 4 # _citation.id primary _citation.title 'NMR structure and interaction analysis of the substrate binding domain of MecA' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.-H.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Jin, C.' 3 ? primary 'Shi, Y.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Adapter protein MecA' _entity.formula_weight 10904.178 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain (UNP residues 1-83)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL SKDLDKLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL SKDLDKLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ILE n 1 4 GLU n 1 5 ARG n 1 6 ILE n 1 7 ASN n 1 8 GLU n 1 9 HIS n 1 10 THR n 1 11 VAL n 1 12 LYS n 1 13 PHE n 1 14 TYR n 1 15 MET n 1 16 SER n 1 17 TYR n 1 18 GLY n 1 19 ASP n 1 20 ILE n 1 21 GLU n 1 22 ASP n 1 23 ARG n 1 24 GLY n 1 25 PHE n 1 26 ASP n 1 27 ARG n 1 28 GLU n 1 29 GLU n 1 30 ILE n 1 31 TRP n 1 32 TYR n 1 33 ASN n 1 34 ARG n 1 35 GLU n 1 36 ARG n 1 37 SER n 1 38 GLU n 1 39 GLU n 1 40 LEU n 1 41 PHE n 1 42 TRP n 1 43 GLU n 1 44 VAL n 1 45 MET n 1 46 ASP n 1 47 GLU n 1 48 VAL n 1 49 HIS n 1 50 GLU n 1 51 GLU n 1 52 GLU n 1 53 GLU n 1 54 PHE n 1 55 ALA n 1 56 VAL n 1 57 GLU n 1 58 GLY n 1 59 PRO n 1 60 LEU n 1 61 TRP n 1 62 ILE n 1 63 GLN n 1 64 VAL n 1 65 GLN n 1 66 ALA n 1 67 LEU n 1 68 ASP n 1 69 LYS n 1 70 GLY n 1 71 LEU n 1 72 GLU n 1 73 ILE n 1 74 ILE n 1 75 VAL n 1 76 THR n 1 77 LYS n 1 78 ALA n 1 79 GLN n 1 80 LEU n 1 81 SER n 1 82 LYS n 1 83 ASP n 1 84 LEU n 1 85 ASP n 1 86 LYS n 1 87 LEU n 1 88 VAL n 1 89 PRO n 1 90 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BSU6633_15767, mecA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'spizizenii ATCC 6633' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 703612 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pYN1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D5N397_BACPN _struct_ref.pdbx_db_accession D5N397 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL SKD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MK6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D5N397 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MK6 LEU A 84 ? UNP D5N397 ? ? 'expression tag' 84 1 1 2MK6 ASP A 85 ? UNP D5N397 ? ? 'expression tag' 85 2 1 2MK6 LYS A 86 ? UNP D5N397 ? ? 'expression tag' 86 3 1 2MK6 LEU A 87 ? UNP D5N397 ? ? 'expression tag' 87 4 1 2MK6 VAL A 88 ? UNP D5N397 ? ? 'expression tag' 88 5 1 2MK6 PRO A 89 ? UNP D5N397 ? ? 'expression tag' 89 6 1 2MK6 ARG A 90 ? UNP D5N397 ? ? 'expression tag' 90 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HN(CO)CA' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY aliphatic' 1 12 1 '3D 1H-13C NOESY aromatic' 1 13 1 '3D HCCH-COSY' 1 14 1 '3D HN(COCA)CB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.3 _pdbx_nmr_exptl_sample_conditions.pH 7.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM [U-13C; U-15N] MecA-NTD, 140 mM sodium chloride, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 800 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MK6 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MK6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 0 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.33 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MK6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal CCPN 'chemical shift assignment' CCPN_Analysis 2 1 CCPN 'data analysis' CCPN_Analysis 2 2 CCPN 'peak picking' CCPN_Analysis 2 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Markus Zweckstetter' 'chemical shift assignment' MARS ? 5 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 2 6 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement Amber 9 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MK6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MK6 _struct.title 'Structure determination of substrate binding domain of MecA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MK6 _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'MecA, competence, proteolysis, GENE REGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 17 ? ARG A 23 ? TYR A 17 ARG A 23 1 ? 7 HELX_P HELX_P2 2 ASP A 26 ? ASN A 33 ? ASP A 26 ASN A 33 1 ? 8 HELX_P HELX_P3 3 ARG A 34 ? GLU A 47 ? ARG A 34 GLU A 47 1 ? 14 HELX_P HELX_P4 4 VAL A 48 ? GLU A 53 ? VAL A 48 GLU A 53 1 ? 6 HELX_P HELX_P5 5 GLN A 79 ? LYS A 82 ? GLN A 79 LYS A 82 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 2 ? ARG A 5 ? GLU A 2 ARG A 5 A 2 VAL A 11 ? SER A 16 ? VAL A 11 SER A 16 A 3 GLY A 70 ? LYS A 77 ? GLY A 70 LYS A 77 A 4 LEU A 60 ? ALA A 66 ? LEU A 60 ALA A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 2 ? N GLU A 2 O TYR A 14 ? O TYR A 14 A 2 3 N MET A 15 ? N MET A 15 O LEU A 71 ? O LEU A 71 A 3 4 O ILE A 74 ? O ILE A 74 N GLN A 63 ? N GLN A 63 # _atom_sites.entry_id 2MK6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ARG 90 90 90 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-02-11 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MecA-NTD-1 1.0 ? mM '[U-13C; U-15N]' 1 'sodium chloride-2' 140 ? mM ? 1 'sodium phosphate-3' 10 ? mM ? 1 'potassium phosphate-4' 1.8 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MK6 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3573 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1507 _pdbx_nmr_constraints.NOE_long_range_total_count 727 _pdbx_nmr_constraints.NOE_medium_range_total_count 525 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 814 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 74 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 75 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH2 A ARG 23 ? ? 117.30 120.30 -3.00 0.50 N 2 3 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH2 A ARG 23 ? ? 116.39 120.30 -3.91 0.50 N 3 3 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH2 A ARG 34 ? ? 117.08 120.30 -3.22 0.50 N 4 4 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.52 120.30 3.22 0.50 N 5 13 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.34 120.30 3.04 0.50 N 6 19 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH2 A ARG 23 ? ? 116.96 120.30 -3.34 0.50 N 7 20 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 117.00 120.30 -3.30 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 9 ? ? -123.81 -50.26 2 1 ARG A 34 ? ? -135.98 -48.01 3 1 GLU A 57 ? ? -147.82 22.88 4 1 LYS A 69 ? ? -141.07 25.54 5 1 LEU A 84 ? ? -159.68 -44.39 6 1 PRO A 89 ? ? -84.51 30.63 7 2 ALA A 55 ? ? -145.02 36.96 8 2 VAL A 56 ? ? -117.47 66.04 9 2 GLU A 57 ? ? -153.18 36.41 10 2 ASP A 83 ? ? -82.74 45.45 11 2 LEU A 84 ? ? -148.64 -55.19 12 3 ASN A 7 ? ? -153.55 17.70 13 3 GLU A 8 ? ? 74.16 -34.63 14 3 GLU A 57 ? ? -155.73 27.73 15 3 LYS A 69 ? ? -140.42 21.69 16 3 SER A 81 ? ? -73.87 42.40 17 3 LEU A 84 ? ? -152.72 -42.01 18 3 LYS A 86 ? ? -95.33 36.67 19 4 LYS A 69 ? ? -140.64 23.08 20 4 LEU A 84 ? ? -152.63 -34.13 21 5 ALA A 55 ? ? -144.71 40.91 22 5 VAL A 56 ? ? -119.94 66.61 23 5 GLU A 57 ? ? -153.89 37.38 24 6 GLU A 47 ? ? -58.92 -9.96 25 6 LEU A 67 ? ? -118.70 -169.97 26 6 LYS A 69 ? ? -142.09 25.30 27 6 SER A 81 ? ? -74.72 45.03 28 6 LEU A 84 ? ? -162.24 -34.89 29 7 HIS A 9 ? ? -129.94 -50.50 30 7 GLU A 47 ? ? -59.61 -9.34 31 7 GLU A 57 ? ? -156.88 30.46 32 7 LYS A 69 ? ? -140.97 25.43 33 7 LEU A 84 ? ? -135.30 -39.31 34 8 GLU A 57 ? ? -161.66 37.77 35 8 LYS A 69 ? ? -141.94 27.03 36 8 SER A 81 ? ? -61.99 1.57 37 8 LEU A 84 ? ? -150.98 -50.23 38 8 ASP A 85 ? ? -147.11 27.61 39 9 LYS A 69 ? ? -140.45 25.67 40 9 LEU A 80 ? ? -142.91 39.33 41 10 HIS A 9 ? ? -130.68 -55.14 42 10 GLU A 57 ? ? -153.64 32.42 43 10 LEU A 67 ? ? -120.14 -169.81 44 10 LYS A 69 ? ? -140.11 22.90 45 10 ASP A 83 ? ? -82.03 34.63 46 10 LEU A 84 ? ? -145.51 -47.52 47 11 GLU A 57 ? ? -156.08 31.69 48 11 LYS A 69 ? ? -140.68 21.81 49 11 LEU A 80 ? ? -144.20 56.31 50 11 SER A 81 ? ? -71.11 35.39 51 11 LEU A 84 ? ? -158.25 -40.68 52 12 GLU A 57 ? ? -152.96 31.78 53 12 LYS A 69 ? ? -142.30 28.15 54 13 LYS A 69 ? ? -141.42 23.93 55 13 LEU A 80 ? ? 34.07 46.89 56 13 ASP A 83 ? ? -77.09 34.24 57 13 LEU A 84 ? ? -143.74 -46.19 58 14 GLU A 57 ? ? -159.97 35.92 59 14 LYS A 69 ? ? -141.34 25.40 60 14 LEU A 84 ? ? -157.45 -37.28 61 15 HIS A 9 ? ? -130.74 -40.81 62 15 GLU A 57 ? ? -152.96 27.63 63 15 LYS A 69 ? ? -141.63 27.79 64 15 ASP A 83 ? ? -144.72 -34.48 65 15 LEU A 84 ? ? 75.32 -28.28 66 16 HIS A 9 ? ? -126.59 -53.82 67 16 GLU A 57 ? ? -161.33 39.09 68 16 LYS A 69 ? ? -140.96 26.30 69 16 LYS A 82 ? ? 64.66 -41.92 70 16 LEU A 84 ? ? -161.00 -41.52 71 17 LYS A 69 ? ? -141.56 25.02 72 17 LEU A 80 ? ? -143.77 40.30 73 17 LYS A 86 ? ? 58.50 175.63 74 18 ALA A 55 ? ? -141.82 -4.86 75 18 PRO A 89 ? ? -85.58 31.03 76 19 GLU A 57 ? ? -159.48 32.37 77 19 LYS A 69 ? ? -140.39 22.00 78 19 SER A 81 ? ? -64.09 1.50 79 19 ASP A 85 ? ? 61.45 -21.89 80 20 HIS A 9 ? ? -123.04 -52.25 81 20 ALA A 55 ? ? -143.24 27.74 82 20 LYS A 69 ? ? -141.78 27.45 83 20 GLN A 79 ? ? -147.09 -41.46 84 20 SER A 81 ? ? -68.13 56.55 85 20 ASP A 83 ? ? -77.75 35.63 86 20 LEU A 84 ? ? -154.85 -43.38 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 9 LEU A 80 ? ? SER A 81 ? ? -146.33 2 10 MET A 1 ? ? GLU A 2 ? ? -145.70 3 10 ILE A 62 ? ? GLN A 63 ? ? 148.93 4 11 MET A 1 ? ? GLU A 2 ? ? -149.76 5 18 VAL A 56 ? ? GLU A 57 ? ? 149.42 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 PHE A 13 ? ? 0.079 'SIDE CHAIN' 2 9 ARG A 36 ? ? 0.084 'SIDE CHAIN' 3 12 PHE A 13 ? ? 0.078 'SIDE CHAIN' #