data_2MMK # _entry.id 2MMK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MMK pdb_00002mmk 10.2210/pdb2mmk/pdb RCSB RCSB103793 ? ? BMRB 19857 ? 10.13018/BMR19857 WWPDB D_1000103793 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-15 2 'Structure model' 1 1 2014-11-05 3 'Structure model' 1 2 2014-11-19 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 4 'Structure model' '_struct_ref_seq_dif.details' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MMK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-03-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19857 BMRB unspecified . 2MMG PDB unspecified . 2MMH PDB unspecified . 2MMI PDB unspecified . 2MML PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bacot-Davis, V.R.' 1 'Porter, F.W.' 2 'Palmenberg, A.C.' 3 # _citation.id primary _citation.title ;Solution structures of Mengovirus Leader protein, its phosphorylated derivatives, and in complex with nuclear transport regulatory protein, RanGTPase. ; _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 111 _citation.page_first 15792 _citation.page_last 15797 _citation.year 2014 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25331866 _citation.pdbx_database_id_DOI 10.1073/pnas.1411098111 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bacot-Davis, V.R.' 1 ? primary 'Ciomperlik, J.J.' 2 ? primary 'Basta, H.A.' 3 ? primary 'Cornilescu, C.C.' 4 ? primary 'Palmenberg, A.C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Leader protein' 8422.004 1 ? ? 'UNP residues 1-67' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GSTAMATTMEQEICAHSMTFEECPKCSALQYRNGFYLLKYDEEW(PTR)PEELL(TPO)DGEDDVFDPDLDMEVVFETQ' _entity_poly.pdbx_seq_one_letter_code_can GSTAMATTMEQEICAHSMTFEECPKCSALQYRNGFYLLKYDEEWYPEELLTDGEDDVFDPDLDMEVVFETQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 ALA n 1 5 MET n 1 6 ALA n 1 7 THR n 1 8 THR n 1 9 MET n 1 10 GLU n 1 11 GLN n 1 12 GLU n 1 13 ILE n 1 14 CYS n 1 15 ALA n 1 16 HIS n 1 17 SER n 1 18 MET n 1 19 THR n 1 20 PHE n 1 21 GLU n 1 22 GLU n 1 23 CYS n 1 24 PRO n 1 25 LYS n 1 26 CYS n 1 27 SER n 1 28 ALA n 1 29 LEU n 1 30 GLN n 1 31 TYR n 1 32 ARG n 1 33 ASN n 1 34 GLY n 1 35 PHE n 1 36 TYR n 1 37 LEU n 1 38 LEU n 1 39 LYS n 1 40 TYR n 1 41 ASP n 1 42 GLU n 1 43 GLU n 1 44 TRP n 1 45 PTR n 1 46 PRO n 1 47 GLU n 1 48 GLU n 1 49 LEU n 1 50 LEU n 1 51 TPO n 1 52 ASP n 1 53 GLY n 1 54 GLU n 1 55 ASP n 1 56 ASP n 1 57 VAL n 1 58 PHE n 1 59 ASP n 1 60 PRO n 1 61 ASP n 1 62 LEU n 1 63 ASP n 1 64 MET n 1 65 GLU n 1 66 VAL n 1 67 VAL n 1 68 PHE n 1 69 GLU n 1 70 THR n 1 71 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain EMCV _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mengo virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12107 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET41B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 PTR 45 45 45 PTR PTR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TPO 51 51 51 TPO TPO A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLN 71 71 71 GLN GLN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 110 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2MMK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MMK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MMK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MMK _struct.title ;Y41 and T47 phosphorylation of the Mengovirus Leader Protein: NMR Studies of the Phosphorylation of the Mengovirus Leader Protein Reveal Stabilization of Intermolecular Domain Interactions ; _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MMK _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text ;animal viruses, positive-strand RNA viruses, cardioviruses, leader, protein phosphorylation, casein kinase 2, spleen tyrosine kinase, VIRAL PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_ENMGO _struct_ref.pdbx_db_accession P12296 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MATTMEQEICAHSMTFEECPKCSALQYRNGFYLLKYDEEWYPEELLTDGEDDVFDPDLDMEVVFETQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MMK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12296 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MMK GLY A 1 ? UNP P12296 ? ? 'expression tag' 1 1 1 2MMK SER A 2 ? UNP P12296 ? ? 'expression tag' 2 2 1 2MMK THR A 3 ? UNP P12296 ? ? 'expression tag' 3 3 1 2MMK ALA A 4 ? UNP P12296 ? ? 'expression tag' 4 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 46 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TPO _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 51 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 46 _struct_conf.end_auth_comp_id TPO _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 51 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TRP 44 C ? ? ? 1_555 A PTR 45 N ? ? A TRP 44 A PTR 45 1_555 ? ? ? ? ? ? ? 1.354 ? ? covale2 covale both ? A PTR 45 C ? ? ? 1_555 A PRO 46 N ? ? A PTR 45 A PRO 46 1_555 ? ? ? ? ? ? ? 1.373 ? ? covale3 covale both ? A LEU 50 C ? ? ? 1_555 A TPO 51 N ? ? A LEU 50 A TPO 51 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale4 covale both ? A TPO 51 C ? ? ? 1_555 A ASP 52 N ? ? A TPO 51 A ASP 52 1_555 ? ? ? ? ? ? ? 1.353 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR A 45 ? . . . . PTR A 45 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 TPO A 51 ? . . . . TPO A 51 ? 1_555 . . . . . . . THR 1 TPO Phosphorylation 'Named protein modification' # _pdbx_entry_details.entry_id 2MMK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 97.07 110.40 -13.33 2.00 N 2 2 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 96.89 110.40 -13.51 2.00 N 3 3 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 97.33 110.40 -13.07 2.00 N 4 4 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 97.70 110.40 -12.70 2.00 N 5 5 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 96.87 110.40 -13.53 2.00 N 6 6 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 97.42 110.40 -12.98 2.00 N 7 7 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 96.94 110.40 -13.46 2.00 N 8 8 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 96.51 110.40 -13.89 2.00 N 9 9 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 96.73 110.40 -13.67 2.00 N 10 10 CB A TYR 36 ? ? CA A TYR 36 ? ? C A TYR 36 ? ? 96.84 110.40 -13.56 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 7 ? ? 71.68 -53.83 2 1 GLU A 10 ? ? 77.79 -4.97 3 1 GLU A 12 ? ? 67.38 169.97 4 1 CYS A 14 ? ? -126.66 -116.96 5 1 ALA A 15 ? ? -96.26 -71.26 6 1 MET A 18 ? ? -129.39 -114.81 7 1 ASN A 33 ? ? -136.15 -72.88 8 2 THR A 7 ? ? 71.65 -53.84 9 2 GLU A 10 ? ? 77.71 -4.97 10 2 GLU A 12 ? ? 67.31 169.94 11 2 CYS A 14 ? ? -126.68 -116.94 12 2 ALA A 15 ? ? -96.27 -71.20 13 2 MET A 18 ? ? -129.48 -114.81 14 2 ASN A 33 ? ? -133.18 -74.47 15 3 THR A 7 ? ? 71.62 -53.85 16 3 GLU A 10 ? ? 77.75 -4.95 17 3 GLU A 12 ? ? 67.37 169.89 18 3 CYS A 14 ? ? -126.65 -116.96 19 3 ALA A 15 ? ? -96.31 -71.23 20 3 MET A 18 ? ? -129.45 -114.85 21 3 ASN A 33 ? ? -135.67 -78.53 22 4 THR A 7 ? ? 71.71 -53.88 23 4 GLU A 10 ? ? 77.78 -5.02 24 4 GLU A 12 ? ? 67.30 169.93 25 4 CYS A 14 ? ? -126.72 -117.02 26 4 ALA A 15 ? ? -96.24 -71.22 27 4 MET A 18 ? ? -129.41 -114.88 28 4 ASN A 33 ? ? -138.44 -71.34 29 5 THR A 7 ? ? 71.63 -53.79 30 5 GLU A 10 ? ? 77.73 -4.96 31 5 GLU A 12 ? ? 67.37 169.96 32 5 CYS A 14 ? ? -126.72 -117.04 33 5 ALA A 15 ? ? -96.26 -71.21 34 5 MET A 18 ? ? -129.36 -114.82 35 5 ASN A 33 ? ? -131.48 -82.27 36 6 THR A 7 ? ? 71.66 -53.80 37 6 GLU A 10 ? ? 77.69 -4.96 38 6 GLU A 12 ? ? 67.44 169.90 39 6 CYS A 14 ? ? -126.74 -116.95 40 6 ALA A 15 ? ? -96.33 -71.17 41 6 MET A 18 ? ? -129.41 -114.84 42 6 ASN A 33 ? ? -134.44 -79.60 43 7 THR A 7 ? ? 71.62 -53.78 44 7 GLU A 10 ? ? 77.80 -5.02 45 7 GLU A 12 ? ? 67.33 169.87 46 7 CYS A 14 ? ? -126.72 -116.97 47 7 ALA A 15 ? ? -96.26 -71.28 48 7 MET A 18 ? ? -129.40 -114.83 49 7 ASN A 33 ? ? -142.36 -75.93 50 8 THR A 7 ? ? 71.60 -53.77 51 8 GLU A 10 ? ? 77.69 -4.93 52 8 GLU A 12 ? ? 67.34 169.96 53 8 CYS A 14 ? ? -126.71 -116.95 54 8 ALA A 15 ? ? -96.27 -71.17 55 8 MET A 18 ? ? -129.44 -114.83 56 8 ASN A 33 ? ? -140.63 -68.31 57 9 THR A 7 ? ? 71.68 -53.80 58 9 GLU A 10 ? ? 77.81 -5.03 59 9 GLU A 12 ? ? 67.34 169.90 60 9 CYS A 14 ? ? -126.68 -116.98 61 9 ALA A 15 ? ? -96.23 -71.27 62 9 MET A 18 ? ? -129.42 -114.85 63 9 ASN A 33 ? ? -134.73 -80.17 64 10 THR A 7 ? ? 71.64 -53.79 65 10 GLU A 10 ? ? 77.83 -5.04 66 10 GLU A 12 ? ? 67.29 169.93 67 10 CYS A 14 ? ? -126.69 -116.91 68 10 ALA A 15 ? ? -96.33 -71.30 69 10 MET A 18 ? ? -129.43 -114.84 70 10 ASN A 33 ? ? -136.81 -70.76 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A PTR 45 A PTR 45 ? TYR O-PHOSPHOTYROSINE 2 A TPO 51 A TPO 51 ? THR PHOSPHOTHREONINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MMK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MMK _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.5 mM [U-100% 13C; U-100% 15N] L Mengo 2P, 20 mM HEPES, 100 mM potassium chloride, 2 mM magnesium chloride, 2 mM DTT, 0.04% sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'L Mengo 2P-1' 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 HEPES-2 20 ? mM ? 1 'potassium chloride-3' 100 ? mM ? 1 'magnesium chloride-4' 2 ? mM ? 1 DTT-5 2 ? mM ? 1 'sodium azide-6' 0.04 ? % ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 102 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HCCH-TOCSY' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '1D 31P' # _pdbx_nmr_refine.entry_id 2MMK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 5 'Shen and Bax' 'geometry optimization' SPARTA+ ? 6 Goddard 'chemical shift assignment' Sparky ? 7 Wuthrich 'chemical shift assignment' CARA ? 8 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 PTR N N N N 287 PTR CA C N S 288 PTR C C N N 289 PTR O O N N 290 PTR OXT O N N 291 PTR CB C N N 292 PTR CG C Y N 293 PTR CD1 C Y N 294 PTR CD2 C Y N 295 PTR CE1 C Y N 296 PTR CE2 C Y N 297 PTR CZ C Y N 298 PTR OH O N N 299 PTR P P N N 300 PTR O1P O N N 301 PTR O2P O N N 302 PTR O3P O N N 303 PTR H H N N 304 PTR H2 H N N 305 PTR HA H N N 306 PTR HXT H N N 307 PTR HB2 H N N 308 PTR HB3 H N N 309 PTR HD1 H N N 310 PTR HD2 H N N 311 PTR HE1 H N N 312 PTR HE2 H N N 313 PTR HO2P H N N 314 PTR HO3P H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TPO N N N N 347 TPO CA C N S 348 TPO CB C N R 349 TPO CG2 C N N 350 TPO OG1 O N N 351 TPO P P N N 352 TPO O1P O N N 353 TPO O2P O N N 354 TPO O3P O N N 355 TPO C C N N 356 TPO O O N N 357 TPO OXT O N N 358 TPO H H N N 359 TPO H2 H N N 360 TPO HA H N N 361 TPO HB H N N 362 TPO HG21 H N N 363 TPO HG22 H N N 364 TPO HG23 H N N 365 TPO HOP2 H N N 366 TPO HOP3 H N N 367 TPO HXT H N N 368 TRP N N N N 369 TRP CA C N S 370 TRP C C N N 371 TRP O O N N 372 TRP CB C N N 373 TRP CG C Y N 374 TRP CD1 C Y N 375 TRP CD2 C Y N 376 TRP NE1 N Y N 377 TRP CE2 C Y N 378 TRP CE3 C Y N 379 TRP CZ2 C Y N 380 TRP CZ3 C Y N 381 TRP CH2 C Y N 382 TRP OXT O N N 383 TRP H H N N 384 TRP H2 H N N 385 TRP HA H N N 386 TRP HB2 H N N 387 TRP HB3 H N N 388 TRP HD1 H N N 389 TRP HE1 H N N 390 TRP HE3 H N N 391 TRP HZ2 H N N 392 TRP HZ3 H N N 393 TRP HH2 H N N 394 TRP HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 ZN ZN ZN N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 PTR N CA sing N N 275 PTR N H sing N N 276 PTR N H2 sing N N 277 PTR CA C sing N N 278 PTR CA CB sing N N 279 PTR CA HA sing N N 280 PTR C O doub N N 281 PTR C OXT sing N N 282 PTR OXT HXT sing N N 283 PTR CB CG sing N N 284 PTR CB HB2 sing N N 285 PTR CB HB3 sing N N 286 PTR CG CD1 doub Y N 287 PTR CG CD2 sing Y N 288 PTR CD1 CE1 sing Y N 289 PTR CD1 HD1 sing N N 290 PTR CD2 CE2 doub Y N 291 PTR CD2 HD2 sing N N 292 PTR CE1 CZ doub Y N 293 PTR CE1 HE1 sing N N 294 PTR CE2 CZ sing Y N 295 PTR CE2 HE2 sing N N 296 PTR CZ OH sing N N 297 PTR OH P sing N N 298 PTR P O1P doub N N 299 PTR P O2P sing N N 300 PTR P O3P sing N N 301 PTR O2P HO2P sing N N 302 PTR O3P HO3P sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TPO N CA sing N N 333 TPO N H sing N N 334 TPO N H2 sing N N 335 TPO CA CB sing N N 336 TPO CA C sing N N 337 TPO CA HA sing N N 338 TPO CB CG2 sing N N 339 TPO CB OG1 sing N N 340 TPO CB HB sing N N 341 TPO CG2 HG21 sing N N 342 TPO CG2 HG22 sing N N 343 TPO CG2 HG23 sing N N 344 TPO OG1 P sing N N 345 TPO P O1P doub N N 346 TPO P O2P sing N N 347 TPO P O3P sing N N 348 TPO O2P HOP2 sing N N 349 TPO O3P HOP3 sing N N 350 TPO C O doub N N 351 TPO C OXT sing N N 352 TPO OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2MMK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S ZN # loop_